Recombinant Ascaris suum NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Ascaris suum NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrial complex I subunit expressed in E. coli for research applications . ND6 is a hydrophobic protein encoded by the mitochondrial genome and plays a critical role in electron transport during oxidative phosphorylation . In Ascaris suum (pig roundworm), ND6 contributes to the parasite’s metabolic adaptability, enabling survival in diverse host environments .

Expression and Purification

  • Host System: Expressed in E. coli .

  • Form: Lyophilized powder or liquid suspension in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Applications in Research

  • Mitochondrial Studies: Used to investigate complex I dysfunction in parasitic nematodes .

  • Comparative Genomics: Supports hybridization studies between A. suum and A. lumbricoides, as their mitochondrial genomes show high similarity .

  • Antigen Development: Potential use in immunoassays for ascariasis diagnostics, though not yet validated for human use .

Key Research Findings

  1. Genetic Hybridization Evidence:

    • Over 63/68 human-derived Ascaris worms in Kenya had mitochondrial genomes clustering closer to A. suum than A. lumbricoides, suggesting zoonotic transmission .

    • Nuclear genomes of these hybrids showed extensive heterozygosity and recombination, forming a genetic mosaic .

  2. Evolutionary Insights:

    • The A. suum ND6 sequence shares 99% identity with the human A. lumbricoides homolog, reflecting minimal divergence .

    • DNA elimination patterns during embryogenesis are identical between A. suum and human Ascaris, underscoring conserved genomic mechanisms .

Comparative Analysis with Other Species

FeatureAscaris suum ND6 Human NDUFS6
Gene LocationMitochondrial genomeNuclear genome (chromosome 5)
Role in Complex IElectron transferIron-sulfur cluster assembly
Recombinant ExpressionE. coliE. coli

Future Directions

  • Functional Studies: Elucidate ND6’s role in parasite-specific energy metabolism.

  • Therapeutic Target Exploration: Screen inhibitors targeting ND6 to disrupt parasitic ATP synthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Target Names
ND6
Target Protein Sequence
MLGSFFFLAIISCVMSYINVDPMKSSFFLIFSLLMVMPLISFFLHVWFSYFICLLFLSGI FVILVYFSSLSKIGYVVTPFYFVGGVLSVFFFYPFFYSVTDVVAVNNFYFSVYWMLLVWV IFVLIFFMNFTSYFLNFSGALRKV
Uniprot No.

Target Background

Function
Recombinant *Ascaris suum* NADH-ubiquinone oxidoreductase chain 6 (ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Ascaris suum ND6?

Escherichia coli is the most commonly used expression system for Recombinant Ascaris suum ND6. The protein is typically expressed with an N-terminal His-tag to facilitate purification. The expression construct often includes the full-length protein (amino acids 1-144) cloned into an appropriate bacterial expression vector .

For optimal expression:

  • Use BL21(DE3) or similar E. coli strains designed for protein expression

  • Induce expression with IPTG at mid-log phase

  • Culture at lower temperatures (16-20°C) after induction to improve solubility

  • Include solubility enhancers like sorbitol or betaine in culture media

While E. coli is predominant, Pichia pastoris has also been successfully used for expressing other Ascaris suum recombinant proteins with proper folding and post-translational modifications, suggesting it might be a viable alternative for ND6 expression when native conformation is critical .

How should recombinant Ascaris suum ND6 be stored to maintain stability and activity?

For optimal stability of recombinant Ascaris suum ND6:

Storage ConditionRecommendationNotes
Short-term storage4°C for up to one weekFor active projects
Long-term storage-20°C/-80°CAliquot to avoid freeze-thaw cycles
Storage bufferTris/PBS-based buffer, pH 8.0, with 6% TrehaloseMaintains protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation before opening
Glycerol addition5-50% (final concentration)Prevents freezing damage

Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided. After reconstitution, the protein solution should be divided into small working aliquots before freezing to minimize the number of freeze-thaw cycles .

What methods are used to verify the identity and purity of recombinant Ascaris suum ND6?

Several complementary techniques are recommended for verifying identity and purity:

  • SDS-PAGE: Standard for purity assessment; recombinant ND6 should appear as a single band at approximately 16-17 kDa (accounting for the His-tag). Purity should exceed 90% .

  • Western Blotting: Using anti-His antibodies or specific anti-ND6 antibodies for identity confirmation.

  • Mass Spectrometry:

    • MALDI-TOF to confirm molecular weight

    • LC-MS/MS for peptide fingerprinting to verify sequence identity

  • Spectroscopic Analysis: For characterizing the association with prosthetic groups or cofactors.

  • Activity Assays: Measurement of NADH oxidation activity using spectrophotometric methods with appropriate electron acceptors.

Researchers should employ at least two different methods to ensure both identity and purity of the recombinant protein .

How can Ascaris suum ND6 be used in immunological studies and vaccine development research?

While ND6 itself has not been specifically documented as a vaccine candidate, research with other Ascaris suum recombinant proteins provides a methodology framework that could be applied to ND6 studies:

  • Immunogenicity Assessment:

    • Express ND6 with appropriate tags in systems ensuring correct folding

    • Evaluate recognition by sera from Ascaris-infected hosts

    • Analyze antibody isotype profiles (IgG subclasses, IgE) in response to immunization

    • Characterize T-cell responses (Th1/Th2 balance) through cytokine profiling

  • Vaccination Strategies:

    • Adjuvant selection is critical - studies with other Ascaris proteins show that Th2-promoting adjuvants (alum, ISA720) are more effective than Th1-promoting ones (MPLA)

    • Multiple immunization doses (typically three) at 2-3 week intervals are optimal

    • Routes of administration (subcutaneous, intranasal) affect immune response profiles

  • Protection Assessment:

    • Challenge with infective Ascaris eggs post-immunization

    • Measure larval recovery from lungs or intestine

    • Assess developmental stages of recovered larvae

    • Evaluate physiological parameters of recovered larvae

For ND6-specific research, scientists should consider its mitochondrial location, which may limit accessibility to the immune system, potentially necessitating adjuvant formulations that enhance presentation of mitochondrial antigens .

What is known about the structure-function relationship of Ascaris suum ND6 and how can this inform drug development?

The structure-function relationship of Ascaris suum ND6 has not been fully characterized, but insights can be drawn from studies of other Ascaris mitochondrial proteins:

  • Structural Considerations:

    • ND6 is likely membrane-embedded with multiple transmembrane domains

    • The protein contains hydrophobic regions consistent with its location in the mitochondrial inner membrane

    • Conserved residues within the NADH-binding domain are crucial for electron transport

  • Functional Domains:

    • NADH-binding regions

    • Ubiquinone interaction sites

    • Proton translocation pathways

    • Subunit interaction interfaces

  • Drug Development Implications:

    • Target unique structural features absent in host homologs

    • Focus on residues involved in electron transport that differ from mammalian counterparts

    • Design inhibitors that disrupt protein-protein interactions within Complex I

    • Explore allosteric sites that might be more accessible than the active site

Computational methods including homology modeling and molecular dynamics simulations would be valuable for predicting structure and identifying potential drug binding sites, especially given that crystal structures specific to Ascaris suum ND6 are not yet available .

How does the genetic variation in ND6 between Ascaris suum and Ascaris lumbricoides impact experimental design?

Recent genomic studies have revealed extensive hybridization between Ascaris suum (pig parasite) and Ascaris lumbricoides (human parasite), which has significant implications for experimental design:

  • Genetic Analysis Findings:

    • Molecular evidence shows hybridization between pig and human Ascaris species

    • Nuclear genomes show extensive recombination between species

    • Out of 68 worms collected from human hosts, 63 possessed mitochondrial genomes closer to A. suum than A. lumbricoides

  • Experimental Design Considerations:

    • Source verification is essential - researchers must genetically characterize their isolates

    • Mitochondrial DNA alone is insufficient for species identification

    • Nuclear markers should be used in conjunction with mitochondrial sequences

    • Whole genome sequencing or targeted SNP panels are recommended for definitive classification

  • Impact on ND6 Research:

    • Variation in ND6 sequences between and within nominal species may affect protein function

    • Expression constructs should be designed based on sequencing of the specific isolate used

    • Functional studies should include comparative analysis of variants

    • Immunological studies must account for epitope variations between isolates

Analysis TypeRecommendation
Species identificationCombined mitochondrial and nuclear markers
Variant characterizationWhole genome sequencing or targeted SNP analysis
Expression construct designBased on specific isolate sequence
Functional comparisonInclude multiple variants in parallel studies

These findings suggest that researchers should treat Ascaris as a genetic complex rather than two distinct species when designing experiments involving ND6 or other mitochondrial proteins .

What methodologies are most effective for studying the role of ND6 in Ascaris suum mitochondrial function?

Several complementary approaches can be used to study ND6 function:

  • In Vitro Biochemical Assays:

    • Enzyme activity measurements using purified recombinant protein

    • Reconstitution of partial or complete electron transport chain complexes

    • Spectrophotometric assays to measure NADH oxidation and ubiquinone reduction

    • Oxygen consumption measurements with intact mitochondrial preparations

  • Genetic Manipulation Approaches:

    • RNA interference (RNAi) to knockdown ND6 expression

    • Direct intestinal perfusion method for delivery of dsRNA to adult worms

    • Targeted mutagenesis to study specific residues

    A novel intestinal perfusion method for controlled delivery of dsRNA into the intestinal lumen of Ascaris suum has been developed, which could be modified to study mitochondrial genes like ND6 in intestinal cells .

  • Structural Biology Techniques:

    • X-ray crystallography or cryo-EM for structural determination

    • Protein-protein interaction studies using pull-down assays

    • Cross-linking mass spectrometry to identify interaction partners

  • Integrative Approaches:

    • Combine proteomic, transcriptomic, and functional studies

    • Compare results across developmental stages

    • Correlate functional changes with gene expression patterns

For accurate assessment of ND6 function, researchers should account for the unique biochemical environment of parasitic nematode mitochondria, which may differ significantly from model organisms .

How can recombinant Ascaris suum ND6 be used to study host-parasite interactions?

Recombinant Ascaris suum ND6 can offer insights into host-parasite interactions through several research approaches:

  • Immunomodulatory Studies:

    • Examine effects on host immune cell populations

    • Investigate impact on dendritic cell maturation and cytokine production

    • Assess influence on T-cell polarization (Th1/Th2 balance)

    Research with Ascaris suum excretory/secretory products has shown differential modulation of porcine dendritic cell subsets, suggesting mitochondrial proteins released during infection might influence host immune responses .

  • Cross-Reactivity Analysis:

    • Evaluate antibody cross-reactivity between parasite and host mitochondrial proteins

    • Assess potential autoimmune implications

    • Investigate evolutionary conservation of epitopes

  • Metabolic Interaction Studies:

    • Compare parasite and host metabolic pathways

    • Identify unique metabolic dependencies

    • Explore metabolic adaptation during different life stages

  • Mitochondrial Stress Responses:

    • Study how host mitochondrial function is affected by parasite proteins

    • Investigate reactive oxygen species generation and mitochondrial dynamics

    • Assess cellular stress responses triggered by parasite mitochondrial proteins

These approaches can help identify potential mechanisms of parasite survival and host immune evasion, as well as novel therapeutic targets that exploit differences between host and parasite mitochondrial function .

What are the challenges in expressing fully functional recombinant Ascaris suum ND6 and how can they be overcome?

Expressing fully functional membrane proteins like ND6 presents several challenges:

  • Solubility Issues:

    • Challenge: Hydrophobic transmembrane domains often lead to protein aggregation

    • Solution: Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Solution: Express as fusion with solubility enhancers (MBP, SUMO, thioredoxin)

    • Solution: Optimize induction conditions (lower temperature, reduced IPTG concentration)

  • Proper Folding:

    • Challenge: Complex folding pathways in membrane proteins

    • Solution: Consider eukaryotic expression systems (P. pastoris, insect cells) that better support folding

    • Solution: Co-express with molecular chaperones

    • Solution: Include appropriate cofactors in culture media

  • Post-translational Modifications:

    • Challenge: E. coli lacks machinery for many eukaryotic modifications

    • Solution: Identify essential modifications through mass spectrometry of native protein

    • Solution: Use eukaryotic expression systems when modifications are critical

  • Functional Assessment:

    • Challenge: Difficult to assess activity outside native environment

    • Solution: Reconstitute in liposomes or nanodiscs to mimic membrane environment

    • Solution: Co-express with interacting partners from Complex I

    • Solution: Develop specialized activity assays with appropriate electron donors/acceptors

Research with other Ascaris proteins suggests that expression in P. pastoris may provide advantages over E. coli for obtaining properly folded and functional mitochondrial proteins, especially when post-translational modifications are important for activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.