Recombinant Ascaris suum Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ascaris suum Succinate Dehydrogenase [Ubiquinone] Cytochrome B Small Subunit, Mitochondrial

Recombinant Ascaris suum Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, is a protein expressed in a host organism like E. coli and is related to the parasitic nematode Ascaris suum . This protein is a component of Complex II (Succinate dehydrogenase, SDH) of the mitochondrial electron transport chain in A. suum . Complex II plays a crucial role in the anaerobic electron transport observed in these organelles .

Key aspects:

  • Source Organism: Ascaris suum (Pig roundworm)

  • Type: Recombinant protein

  • Part of: Complex II (Succinate dehydrogenase)

  • Localization: Mitochondria

  • Function: Electron transport chain

Recombinant Production and Applications

The recombinant form of this protein is typically produced in hosts like E. coli for research purposes . It can be used in various applications, including:

  • Vaccine Development: Recombinant Ascaris suum antigens, such as rAs24, have been evaluated as vaccine candidates for controlling Ascaris infections .

  • Immunological Studies: Studying the immune responses induced by Ascaris antigens to understand host-protective immunity .

  • Enzyme Activity Assays: Analyzing the fumarate reductase and succinate dehydrogenase activities of Complex II .

Immunological Research

Recombinant Ascaris suum antigens have been tested for their potential in inducing host-protective immunity against Ascaris infections . For example, vaccination with recombinant 24-kDa antigen from A. suum (rAs24) resulted in protection against challenge infections in a mouse model .

Key Findings:

  • Reduced Larvae Recovery: Immunization with rAs24 resulted in a 58% reduction in the recovery of A. suum lung-stage larvae .

  • Increased IgG Levels: Sera from immune-protected mice showed significantly increased levels of IgG .

  • Th1/Th2 Cytokine Secretion: Splenic T cells from rAs24-immunized mice secreted high levels of both Th1 cytokine gamma-interferon and Th2 cytokine interleukin-10 .

Relevant Data

The following tables summarize relevant data about the Ascaris suum Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial:

Table 1: Recombinant Protein Details

FeatureDescription
Product OverviewRecombinant Full Length Ascaris suum Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Protein (P92507) (26-156aa), fused to N-terminal His tag, was expressed in E. coli .
HostE. coli, Yeast, Baculovirus, Mammalian Cell
PurityGreater or equal to 85% purity as determined by SDS-PAGE
TagHis-Tagged

Table 2: Immunological Response to Recombinant Ascaris suum Antigens

ResponseObservation
Larvae ReductionImmunization with rAs24 resulted in a 58% reduction (P<0.001) in recovery and stunted development of A. suum lung-stage larvae at day 7 post-challenge .
Antibody ResponseSignificantly increased level of IgG (P<0.0001) in immune protected mice .
IgG Subclass ProfilesIgG1 (P<0.0001) showed the greatest increase followed by IgG2b (P<0.005), IgG2a (P<0.006) and IgG3 (P<0.04) .
Cytokine SecretionSplenic T cells secreted significantly high levels of both Th1 cytokine gamma-interferon (P<0.005) and Th2 cytokine interleukin-10 (P<0.001) .
Inhibition of Larval MoultingAffinity purified anti-rAs24 IgG inhibited moulting of A. suum lung-stage L3 to L4 in vitro by 26% .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; Cytochrome b558 small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-156
Protein Length
Full Length of Mature Protein
Species
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Target Protein Sequence
GATSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMD LCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVG LTRAFEMVWEL
Uniprot No.

Target Background

Function
This protein is a membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. Its function is to transfer electrons from succinate to ubiquinone (coenzyme Q).
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Ascaris suum Succinate Dehydrogenase and why is it significant for research?

Ascaris suum succinate dehydrogenase (SDH) is a key mitochondrial enzyme involved in both the tricarboxylic acid cycle and the electron transport chain, functioning as Complex II. It catalyzes the oxidation of succinate to fumarate while reducing ubiquinone. This enzyme is particularly significant because A. suum expresses stage-specific isoforms of complex II: the flavoprotein subunit and the small subunit of cytochrome b (CybS) in larval stages differ from those in adult stages, while they share a common iron-sulfur cluster subunit (Ip) . This stage-specific expression represents an adaptation to the dramatic changes in oxygen availability that the parasite encounters during its life cycle and host infection process, making it an excellent model for studying metabolic adaptation mechanisms .

How does A. suum SDH differ between larval and adult stages?

Analysis of A. suum SDH has revealed important stage-specific differences:

  • The larval and adult cytochrome b large subunits (CybL) are identical based on peptide mass fingerprinting and N-terminal amino acid sequencing .

  • The small subunit of cytochrome b (CybS) exists in two distinct isoforms: larval (CybS(L)) and adult (CybS(A)) .

  • Northern blot analysis and immunoblotting confirm stage-specific expression of these isoforms in their respective developmental stages .

  • Functionally, the adult form shows higher fumarate reductase (FRD) activity compared to the larval form, although both forms demonstrate similar ratios of rhodoquinol-fumarate reductase (RQFR) to succinate-ubiquinone reductase (SQR) activities and comparable Km values for quinones .

What methods are used to measure SDH activity in research settings?

Several methodological approaches exist for measuring SDH activity, each with specific advantages:

  • Direct measurement: SDH activity can be measured directly by following the reduction of an artificial electron acceptor like 2,6-dichlorophenolindophenol (DCPIP) in the presence of phenazine methosulfate (PMS). This method spectrophotometrically tracks the color change of DCPIP .

  • Succinate-cytochrome c reductase activity (SCCR): When cytochrome c is used as the terminal acceptor, SDH activity is estimated as SCCR activity, which is quantified by following the reduction of cytochrome c spectrophotometrically. This method is specific but requires verification that Complex III activity is significantly higher than SDH activity to avoid underestimation .

  • Oxygen consumption measurement: Using isolated mitochondria or permeabilized cells, oxygen consumption related to succinate oxidation can be measured. This approach preserves mitochondrial structure but involves multiple respiratory chain components (Complexes III, IV, and V) .

  • Confocal-based quantitative histochemical technique: This method allows determination of the maximum velocity of the SDH reaction (SDHmax) in single cells, correlating with mitochondrial volume density .

For accurate assessment, it is recommended to couple SDH activity measurements with additional enzyme assays under identical conditions, ideally running them sequentially to account for variations in mitochondrial numbers across samples .

How can stage-specific A. suum complex II be expressed and purified for biochemical studies?

The expression and purification of stage-specific A. suum complex II components involve several critical steps:

  • cDNA isolation and characterization: First, identify and isolate cDNA encoding the target subunit (e.g., CybS) from both larval and adult stages of A. suum. This typically involves RNA extraction from stage-specific tissues, followed by reverse transcription to generate cDNA .

  • Recombinant expression system design: Design appropriate expression vectors containing the target gene. For A. suum proteins, E. coli expression systems have been successfully used . Specifically:

    • Design primers with appropriate restriction sites for directional cloning

    • Amplify the target gene using PCR (e.g., "A partial coding region of As14 cDNA was amplified by PCR" as described for As14)

    • Clone the PCR product into a suitable expression vector

  • Protein expression optimization: Optimize expression conditions including temperature, induction parameters, and culture media to maximize protein yield and solubility.

  • Purification protocol: Develop a multi-step purification strategy:

    • Initial purification using affinity chromatography (if a tag system is used)

    • Further purification through ion-exchange chromatography

    • Size exclusion chromatography for final polishing

    • Verify purity through SDS-PAGE and Western blotting

  • Functional verification: Assess the enzymatic activity of the purified recombinant protein using activity assays specific for SDH function .

This methodological approach allows for comparative studies between the larval and adult forms of the protein, enabling detailed structural and functional analyses.

What are the methodological approaches for studying subcellular distribution of SDH activity in single cells?

Investigation of subcellular SDH distribution requires sophisticated imaging and analytical techniques:

  • 3D confocal imaging: This technique allows for visualization of labeled mitochondria and SDH activity within different compartments of individual cells. Studies have successfully applied this approach to human airway smooth muscle (hASM) cells to analyze the heterogeneous distribution of mitochondria and SDH activity .

  • Concentric shell analysis method: This analytical approach quantifies mitochondrial parameters relative to the distance from the nuclear membrane, including:

    • Mitochondrial volume density

    • Mitochondrial complexity index (measuring the degree of mitochondrial fragmentation vs. fusion)

    • SDHmax values

  • Quantitative histochemical technique: This method determines the maximum velocity of the SDH reaction in situ within cells, providing spatial resolution of enzyme activity .

  • Normalization to mitochondrial volume: To distinguish between variations in SDH activity due to mitochondrial abundance versus intrinsic enzyme activity differences, measurements should be normalized to mitochondrial volume .

Research has revealed that mitochondria within individual cells are morphologically heterogeneous, with more filamentous structures in the perinuclear region and more fragmented mitochondria in distal parts of the cell. SDHmax correlates with mitochondrial volume density, peaking in the perinuclear region. Interestingly, when normalized to mitochondrial volume, SDHmax is lower in the perinuclear region compared to distal cellular compartments .

What factors regulate SDH activity and how can they be experimentally manipulated?

SDH activity is regulated by multiple factors that can be experimentally manipulated:

  • Redox state regulation:

    • SDH is activated under conditions where ubiquinone pools are relatively reduced (e.g., anaerobiosis)

    • The enzyme can operate in both reduced (state 4) and oxidized (state 3) states

    • The reduction level of redox centers (1 Flavin, 3 FeS, 1 haem) controls superoxide production

  • Cofactor regulation:

    • ATP binding to SDHA upregulates SDH activity under high ATP/ADP ratio conditions (mitochondrial state 4)

    • Oxaloacetate (OAA) binding to SDHA downregulates or inhibits SDH activity under high ADP/ATP conditions (state 3)

  • Experimental manipulation approaches:

    • Substrate site inhibition: Malonate binds to the substrate site on the Fp subunit

    • Quinone-binding site inhibition: Thenoyltrifluoroacetone (TTFA) binds to the quinone-binding site

    • Metabolic manipulation: Altering the ATP/ADP ratio or oxaloacetate concentrations

    • Oxygen availability modulation: Controlling oxygen tension to study adaptation mechanisms

  • pH effects:

    • Enzyme activity is strongly influenced by pH

    • Buffer solutions should be used to set and maintain specific pH values during experiments

Importantly, similar inhibition of electron flux by different inhibitors can result in opposite effects on superoxide production due to divergent effects on the redox centers' status, making it challenging to predict the actual consequences of genetic mutations or chemical inhibitors .

How effective are recombinant A. suum proteins as vaccine candidates against ascariasis?

Research on recombinant A. suum proteins as vaccine candidates has shown promising results:

  • Recombinant A. suum 14-kDa antigen (rAs14):

    • Evaluated as a vaccine candidate against ascariasis

    • Expressed in E. coli expression systems

  • Recombinant A. suum 24-kDa antigen (rAs24):

    • Immunization of BALB/c mice with three consecutive doses of rAs24 in Freund's Complete Adjuvant (FCA) resulted in:

      • 58% reduction (P<0.001) in recovery of A. suum lung-stage larvae

      • Stunted development of larvae at day 7 post-challenge

    • Immune response analysis showed:

      • Significantly increased immunoglobulin G (IgG) levels (P<0.0001)

      • No IgE response

      • IgG subclass profile showed highest increase in IgG1 (P<0.0001), followed by IgG2b, IgG2a, and IgG3

      • Splenic T cells secreted high levels of both Th1 cytokine gamma-interferon and Th2 cytokine interleukin-10

  • Functional significance:

    • Affinity-purified anti-rAs24 IgG inhibited moulting of A. suum lung-stage L3 to L4 in vitro by 26%

    • This indicates an in vivo function of the endogenous As24 in the moulting processes

    • Immunofluorescence showed intense expression of endogenous As24 in the hypodermis and gut epithelium of A. suum lung-stage L3

These findings contribute to understanding the Th1/Th2-mediated effector mechanisms required for protection against A. suum larval infection and suggest recombinant A. suum proteins have significant potential as vaccine candidates.

What are the optimal conditions for measuring SDH activity in complex biological samples?

Measuring SDH activity in complex biological samples requires careful attention to several methodological considerations:

  • Buffer selection and pH control:

    • Enzyme activity is strongly influenced by pH

    • Use appropriate buffer solutions to set and maintain specific pH values

    • Common buffers include phosphate buffer (pH 7.0-7.5) for physiological conditions

  • Assay type selection:

    • Discontinuous assays: Mix substrate and enzyme, measure product formed after a set time

      • Advantages: Easy and quick to perform

      • Best used for: Preliminary investigations or well-characterized systems

    • Continuous assays: Mix enzyme with substrate and continuously measure product appearance over time

      • Advantages: Provides real-time kinetic data

      • Often uses chromogens yielding colored products for spectrophotometric measurement

  • Initial velocity measurement:

    • Focus on measuring reaction rates at the early stage (initial velocity, v₀)

    • The rate is effectively linear at this stage, allowing straightforward gradient calculation

    • Divide concentration change by time interval to evaluate reaction rate

  • Enzyme concentration relationship:

    • Establish the linear relationship between enzyme concentration and reaction rate

    • Doubling enzyme concentration typically doubles reaction rate

  • Coupled measurements:

    • Run measurements sequentially for multiple enzymes under identical conditions

    • Calculate ratios between enzyme activities to account for variations in mitochondrial numbers

    • This approach is crucial as mitochondrial numbers can vary up to 10-fold across samples

  • Substrate saturation:

    • Ensure substrate concentrations are at saturating levels to measure maximal activity

    • Consider potential substrate inhibition at very high concentrations

How can stage-specific differences in A. suum complex II be accurately characterized?

Accurate characterization of stage-specific differences in A. suum complex II requires comprehensive analysis at multiple levels:

  • Genetic analysis:

    • RNA extraction and cDNA synthesis from different life stages

    • PCR amplification of target genes

    • cDNA sequencing to identify differences between larval and adult forms

    • Northern blot analysis to confirm stage-specific expression patterns

  • Protein analysis:

    • SDS-PAGE for molecular weight determination

    • Peptide mass fingerprinting for protein identification

    • N-terminal amino acid sequencing

    • Immunoblotting with stage-specific antibodies

  • Enzymatic activity comparison:

    • Measure and compare:

      • Succinate-ubiquinone reductase (SQR) activity

      • Rhodoquinol-fumarate reductase (RQFR) activity

      • Fumarate reductase (FRD) activity

    • Determine Km values for different quinones

  • Functional analysis under varying conditions:

    • Test enzyme function under aerobic vs. anaerobic conditions

    • Evaluate the response to different inhibitors

    • Analyze adaptation to environmental changes mimicking host infection

This multi-level analysis revealed that while larval and adult cytochrome b (CybL) proteins are identical, the small subunit of cytochrome b (CybS) exists in two distinct isoforms with stage-specific expression. Functionally, both forms have similar SQR/RQFR activity ratios and Km values for quinones, but the adult form shows higher FRD activity .

What are the key considerations for designing recombinant expression systems for A. suum proteins?

Designing effective recombinant expression systems for A. suum proteins requires attention to several critical factors:

  • Expression host selection:

    • E. coli systems have been successfully used for A. suum proteins

    • Consider codon optimization for the expression host

    • Evaluate potential toxicity of the target protein to the host

  • Vector design considerations:

    • Select appropriate promoter strength and inducibility

    • Include suitable affinity tags for purification (His-tag, GST, etc.)

    • Consider fusion partners to enhance solubility

    • Include protease cleavage sites if tag removal is required

  • Expression optimization parameters:

    • Temperature (lower temperatures often enhance proper folding)

    • Induction conditions (inducer concentration, timing, duration)

    • Growth media composition

    • Cell density at induction

  • Solubility enhancement strategies:

    • Co-expression with chaperones

    • Use of solubility-enhancing fusion partners

    • Optimization of lysis buffer composition

    • Consideration of refolding protocols if inclusion bodies form

  • Functional verification approaches:

    • Enzyme activity assays specific to SDH function

    • Structural characterization (CD spectroscopy, thermal stability)

    • Binding assays with known interactors or substrates

  • Scale-up considerations:

    • Consistent reproducibility between small and large-scale preparations

    • Optimization of purification protocols for larger volumes

    • Stability assessment during storage

Successful expression of recombinant A. suum proteins has been demonstrated for several antigens, including the 14-kDa antigen (As14) and 24-kDa antigen (As24) , providing precedents for effective expression strategies.

What are the unresolved questions regarding the role of SDH in superoxide production and oxidative stress?

Several important questions remain unresolved regarding SDH's role in superoxide production:

  • Superoxide production mechanisms:

    • The relationship between electron flow rates and superoxide production is complex

    • Rather than electron flux rates, it is the enzyme reduction level that determines superoxide production magnitude

    • Similar inhibition of electron flux by different inhibitors (malonate vs. TTFA) results in opposite effects on superoxide production due to divergent effects on redox centers' status

  • Microdomains involved in superoxide production:

    • Evidence suggests specific microdomains exist at the enzyme level involved in superoxide production

    • Studies indicate that reverse electron flow through Complex I is not the origin of superoxide production linked to succinate metabolism

    • The precise structural and functional characteristics of these microdomains remain poorly understood

  • Physiological vs. pathological superoxide production:

    • SDH represents a perennial source of superoxides, maintaining sustained activity even under reduced conditions

    • Superoxides are involved in many vital cellular processes including cell differentiation, proliferation, and death

    • The balance between beneficial signaling and detrimental oxidative damage remains unclear

  • SDH mutations and superoxide production:

    • The impact of genetic mutations or chemical inhibitors on superoxide production is difficult to predict

    • The potential uncoupling between rates of electron flow and levels of superoxide production complicates analysis

Future research should focus on elucidating the precise mechanisms of microdomains in superoxide production, developing methods to distinguish between physiological and pathological superoxide production, and better understanding how specific mutations affect this critical balance.

How can understanding A. suum SDH adaptation mechanisms inform drug development strategies?

Understanding A. suum SDH adaptation mechanisms offers several potential avenues for drug development:

  • Targeting stage-specific isoforms:

    • A. suum expresses stage-specific isoforms of complex II components

    • The small subunit of cytochrome b (CybS) exists as distinct larval and adult isoforms

    • This stage-specificity could be exploited to develop drugs targeting specific life cycle stages

  • Metabolic adaptation to oxygen availability:

    • A. suum complex II functions as both succinate-ubiquinone reductase (SQR) under aerobic conditions and rhodoquinol-fumarate reductase (RQFR) under anaerobic conditions

    • This adaptability is essential for survival during host infection when oxygen availability changes dramatically

    • Targeting this unique metabolic flexibility could disrupt the parasite's life cycle

  • Structural and functional differences from host enzymes:

    • Both adult and larval A. suum complex II have different properties than the complex II of the mammalian host

    • These differences could be exploited to design selective inhibitors that target the parasite enzyme while sparing host enzymes

  • Quinone binding site variations:

    • Differences in the quinone binding site between host and parasite SDH could be exploited

    • Succinate dehydrogenase inhibitors (SDHI) interacting with the quinone binding site might be developed with parasite specificity

  • Functional inhibition approaches:

    • Anti-A. suum antibodies have been shown to inhibit specific parasite functions

    • For example, anti-rAs24 IgG inhibits moulting of A. suum lung-stage L3 to L4 in vitro

    • This suggests the potential for developing biological therapeutics that target specific parasite processes

Research in these areas could lead to novel anthelmintic treatments that exploit the unique adaptations of A. suum SDH to its parasitic lifestyle.

What immunological mechanisms underlie the protective effect of recombinant A. suum proteins as vaccine candidates?

Research into recombinant A. suum proteins as vaccine candidates has revealed complex immunological mechanisms:

  • Antibody response profile:

    • Immunization with recombinant A. suum 24-kDa antigen (rAs24) resulted in significantly increased IgG levels

    • No significant IgE response was observed

    • IgG subclass analysis showed predominant IgG1 response, followed by IgG2b, IgG2a, and IgG3

  • Cytokine production patterns:

    • Splenic T cells from immunized mice secreted high levels of both:

      • Th1 cytokine gamma-interferon (IFN-γ)

      • Th2 cytokine interleukin-10 (IL-10)

    • This indicates a mixed Th1/Th2 immune response is involved in protection

  • Functional antibody effects:

    • Affinity-purified anti-rAs24 IgG inhibited moulting of A. suum lung-stage L3 to L4 in vitro by 26%

    • This suggests antibodies directly interfere with parasite development processes

  • Antigen localization significance:

    • Immunofluorescence showed intense expression of endogenous As24 in the hypodermis and gut epithelium of A. suum lung-stage L3

    • This expression pattern correlates with the functional importance of these structures in parasite development and host interaction

  • Protection metrics:

    • Vaccination resulted in 58% reduction in recovery of A. suum lung-stage larvae

    • Larvae recovered from vaccinated animals showed stunted development

These findings suggest that effective protection likely involves both antibody-mediated effector functions that directly inhibit parasite development and T cell-mediated immunity with a balanced Th1/Th2 response. Further research is needed to fully elucidate these mechanisms and optimize vaccine formulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.