Recombinant Ashbya gossypii 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TSC10; AEL164C; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TSC10
Target Protein Sequence
MKYELNGQVVLISGGSQGLGRAFAQKYIEESDSTVVIVSRSEEKLTRAGEAICGGARRLG AGGAGRLLYYACNLGDAAAVGGLFATLADAGLQVTQVLFCAGGAVPGLFAELSSAQLAAG VEMNYGTALHLAHGAVRHGARHLVFFSSAAAVYPFIGYSQYAPLKAALRALVAVLRQECD GVRVSCVYPGNFASEGYAEENRTKPAITAAIEGSSEAISCAACCDKIVRGLRSGYDDVTT DFVGWLLLACNMGFNYHSTTYFLWPLGWLLGALVNLLVVPIYMLLCRWDIHKWRTQREET HLAAKTD
Uniprot No.

Target Background

Function

Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of TSC10 in Ashbya gossypii?

TSC10 in Ashbya gossypii functions as a 3-ketodihydrosphingosine reductase, catalyzing the second step in the de novo sphingolipid biosynthesis pathway. Specifically, it reduces 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine) . This enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and requires NADPH as a cofactor for catalytic activity . The reaction represents a critical step in sphingolipid metabolism, which is essential for membrane structure and various cellular signaling processes in fungi.

How does TSC10 structurally compare to other 3-ketodihydrosphingosine reductases?

While the specific crystal structure of Ashbya gossypii TSC10 has not been fully characterized in the provided research, structural data from related fungal homologs provides valuable insights. The crystal structure of TSC10 from Cryptococcus neoformans (cnTSC10) reveals a Rossmann fold with a central seven-stranded β-sheet flanked by α-helices on both sides, which is characteristic of SDR family enzymes . Comparative studies between fungal TSC10 and mammalian KDSR (also known as FVT1) indicate significant differences in topology despite catalyzing the same reaction . Most notably, Tsc10p (the S. cerevisiae homolog) contains only a single membrane-embedded domain between residues 257 and 303, positioning the majority of the protein, including the active site and ER retrieval signal, in the cytosol . In contrast, FVT1 has both a C-terminal membrane-associated segment and an N-terminal membrane-spanning domain that facilitates ER localization .

What expression systems are suitable for recombinant production of A. gossypii TSC10?

Recombinant expression of A. gossypii TSC10 can be accomplished using several expression systems depending on research objectives. For structural and functional studies, heterologous expression in E. coli using vectors with strong promoters (T7, tac) has been successfully employed for related sphingolipid biosynthetic enzymes. For more native-like post-translational modifications, yeast expression systems such as Saccharomyces cerevisiae or Pichia pastoris can be utilized with vectors containing constitutive (ADH1) or inducible (GAL1) promoters . When working specifically within A. gossypii for metabolic engineering applications, several strong promoters have been characterized including PCCW12, PSED1, and other medium/weak promoters like PTSA1 and PHSP26 . Careful selection of promoter strength is essential based on whether overexpression or controlled expression is desired.

How can one establish a reliable assay system for A. gossypii TSC10 enzymatic activity?

A sensitive and reliable assay for A. gossypii TSC10 enzymatic activity can be established using a radiometric approach similar to that developed for comparative studies of yeast and mammalian 3-KDS reductases . This methodology involves:

  • Substrate preparation: Synthesize or obtain 3-ketodihydrosphingosine substrate. For radiometric assays, [3H]-labeled substrate can be prepared by incubating [3H]serine with palmitoyl-CoA and serine palmitoyltransferase.

  • Enzyme preparation: Express recombinant A. gossypii TSC10 with appropriate epitope tags (HA, MYC, or GFP) for detection and purification . Purify using affinity chromatography with appropriate detergents to maintain enzyme activity.

  • Reaction conditions: The standard reaction mixture should contain:

    • Purified enzyme preparation

    • 3-ketodihydrosphingosine substrate (1-10 μM)

    • NADPH (100-200 μM)

    • Buffer system (typically phosphate buffer, pH 7.2-7.4)

    • Appropriate detergent (0.1% Triton X-100)

  • Analysis methods:

    • For radiometric assays: Separate reaction products by thin-layer chromatography and quantify using scintillation counting

    • Alternative approach: LC-MS/MS for direct quantification of dihydrosphingosine formation

    • Spectrophotometric monitoring of NADPH consumption at 340 nm

  • Controls: Include enzyme-free controls and heat-inactivated enzyme preparations to establish background levels.

This assay system allows for both characterization of wild-type enzyme kinetics and evaluation of site-directed mutants targeting the catalytic triad residues .

What strategies can be employed to improve recombinant TSC10 expression and stability?

Optimizing recombinant A. gossypii TSC10 expression and stability requires addressing several challenges related to membrane-associated proteins:

  • Codon optimization: Adapt the TSC10 coding sequence to the preferred codon usage of the expression host to enhance translation efficiency.

  • Fusion partners and tags: Incorporate fusion partners that enhance solubility (MBP, SUMO) while maintaining function. C-terminal tagging with HA, MYC, or GFP has been successfully applied to TSC10 homologs without disrupting function .

  • Membrane association management: Based on topology studies of related enzymes, design constructs that:

    • Retain the C-terminal membrane-embedded domain (residues analogous to 257-303 in yeast Tsc10p)

    • Include the ER retention signal if native localization is desired

    • Consider soluble domain expression for structural studies

  • Expression conditions optimization:

    ParameterOptimization StrategyExpected Outcome
    TemperatureLower to 16-20°C during inductionReduced aggregation, improved folding
    Induction timingInduce at mid-log phase (OD600 0.6-0.8)Balance between growth and expression
    Media compositionSupplement with 0.5-1% glucoseEnhanced energy for protein synthesis
    Induction strengthUse titratable promoter systemsControl expression level to prevent toxicity
  • Stabilizing additives: Include glycerol (10-15%), reducing agents, and appropriate detergents in purification buffers to maintain protein stability.

  • Native promoter selection: When expressing in A. gossypii, strong promoters like PCCW12 (identified in search result ) can be used for overexpression, while medium-strength promoters like PTSA1 or PHSP26 may provide more controlled expression levels .

How does one design site-directed mutagenesis experiments to investigate TSC10 catalytic mechanism?

Based on structural and functional studies of related 3-ketodihydrosphingosine reductases, site-directed mutagenesis experiments for A. gossypii TSC10 should target:

  • Catalytic triad residues: The SDR family typically contains a conserved catalytic triad. Based on homology with other TSC10 proteins, mutations should target the predicted:

    • Serine residue (nucleophile)

    • Tyrosine residue (proton donor)

    • Lysine residue (stabilizes cofactor binding)

  • NADPH binding motif: The Rossmann fold contains a characteristic NADPH binding motif. Mutagenesis of key residues in this region can elucidate specificity determinants for NADPH versus NADH.

  • Mutagenesis protocol:

    • Use QuikChange mutagenesis (QCM) as successfully applied for TSC10 and FVT1 mutations

    • Design primers with 15-18 nucleotides flanking each side of the mutation site

    • Validate mutations by sequencing

    • Express mutants in appropriate systems (E. coli or yeast)

  • Functional assessment:

    • Compare enzyme kinetics (Km, kcat, kcat/Km) between wild-type and mutant enzymes

    • Assess substrate specificity changes

    • Determine changes in NADPH binding affinity

  • Complementation testing:

    • Test mutant constructs for their ability to complement tsc10Δ yeast mutants, which exhibit temperature-sensitive growth defects

    • Evaluate sphingolipid profiles in complemented strains

This systematic mutagenesis approach provides insights into structure-function relationships and validates potential targets for inhibitor design.

How can A. gossypii TSC10 be utilized in metabolic engineering approaches?

A. gossypii TSC10 can be integrated into metabolic engineering strategies through several approaches:

  • Sphingolipid pathway modulation:

    • Overexpression of TSC10 using strong promoters like PCCW12 or PSED1 can increase flux through the sphingolipid biosynthetic pathway

    • Controlled expression using medium/weak promoters (PTSA1, PHSP26) allows fine-tuning of pathway flux

    • Combined with modifications to other pathway enzymes for desired sphingolipid profiles

  • Integration with lipid metabolism engineering:

    • A. gossypii has been successfully engineered for increased lipid production (up to fourfold enhancement) by manipulating fatty acyl-CoA pools

    • TSC10 modification can be coordinated with alterations in fatty acid metabolism to channel precursors toward specific lipid classes

    • Targeting the interaction between sphingolipid biosynthesis and ergosterol pathways through TSC10 and other enzymes

  • Growth media optimization:

    • A. gossypii can utilize various carbon sources including oils, glycerol, and sucrose

    • Engineer TSC10 expression to respond to different carbon sources through appropriate promoter selection

    • Coordinate TSC10 expression with growth phases for optimal product formation

  • Heterologous pathway integration:

    • Combine optimized TSC10 expression with other engineered pathways (e.g., terpene biosynthesis) in A. gossypii, which has proven to be a versatile platform for production of diverse compounds from agro-industrial wastes

The natural ability of A. gossypii to utilize low-cost industrial waste-based culture media makes it a particularly attractive host for metabolic engineering applications involving TSC10 and sphingolipid pathway manipulation .

What analytical methods are most appropriate for characterizing TSC10 structural modifications?

Comprehensive characterization of A. gossypii TSC10 structural modifications requires a multi-modal analytical approach:

  • X-ray crystallography:

    • Similar to the approach used for Cryptococcus neoformans TSC10

    • Focus on co-crystallization with NADPH to understand cofactor binding

    • Address challenges of flexible regions, particularly the substrate loop and C-terminal regions

    • Resolution of 2.0-2.5 Å is typically needed to visualize key interactions

  • Membrane topology mapping:

    • Use glycosylation cassette (GC) reporters inserted at various positions to determine membrane topology

    • Complement with protease protection assays to confirm orientation

    • Fluorescence microscopy with GFP fusions to validate localization

  • Oligomerization analysis:

    • Size exclusion chromatography to determine predominant oligomeric states (dimer vs tetramer)

    • Chemical crosslinking followed by SDS-PAGE to capture transient interactions

    • Analytical ultracentrifugation for precise determination of oligomeric distribution

  • Mass spectrometry approaches:

    MethodApplicationKey Parameters
    HDX-MSConformational dynamicsDeuterium exchange times from 10 sec to 4 hrs
    Native MSIntact complex analysisGentle ionization, 2000-8000 m/z range
    Crosslinking-MSInterface mappingBS3 or DSS crosslinkers, 10-30 Å distance constraints
    Targeted proteomicsPost-translational modificationsMRM or PRM assays for specific peptides
  • Molecular dynamics simulations:

    • Complement experimental data with simulations of TSC10 in membrane environments

    • Focus on flexible regions identified in crystal structures

    • Predict effects of mutations on structure and dynamics

This integrated analytical workflow enables comprehensive characterization of both wild-type TSC10 and engineered variants with improved properties.

How does A. gossypii TSC10 differ from homologous enzymes in other organisms?

A comparative analysis reveals several distinctive features of A. gossypii TSC10 relative to homologs from other organisms:

  • Topological differences:

    • Fungal TSC10 proteins (including A. gossypii) typically contain a single C-terminal membrane-embedded domain, positioning most of the protein in the cytosol

    • This contrasts with mammalian KDSR/FVT1, which has both N- and C-terminal membrane-spanning domains

    • The dilysine ER retention motif present in yeast Tsc10p is conserved in A. gossypii but absent in mammalian homologs

  • Oligomerization properties:

    • While Cryptococcus neoformans TSC10 forms predominantly dimers with a minor tetrameric fraction , the oligomeric state of A. gossypii TSC10 must be experimentally determined

    • The dimer interface involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, and the loop connecting strand β4 and helix α4

    • Interface residues forming hydrogen bonds and salt bridges are not conserved between fungal and mammalian enzymes

  • Substrate and inhibitor specificities:

    • Different binding pocket architectures may confer unique substrate specificities

    • These differences can be exploited for the development of fungal-specific inhibitors that target the dimer interface

  • Regulatory mechanisms:

    • Expression patterns and responses to cellular stress likely differ between organisms

    • A. gossypii promoters like PTSA1 and PHSP26 suggest regulation under specific conditions

These comparative insights are crucial for understanding the evolution of sphingolipid biosynthesis and for developing targeted approaches to modulate TSC10 activity in different organisms.

What are the major challenges in expressing and characterizing recombinant A. gossypii TSC10?

Researchers face several significant challenges when working with recombinant A. gossypii TSC10:

  • Membrane protein expression barriers:

    • The C-terminal membrane-embedded domain complicates heterologous expression

    • Proper folding and orientation in expression hosts is difficult to control

    • Detergent selection critically impacts activity and stability

  • Structural flexibility challenges:

    • Based on related TSC10 structures, several regions exhibit significant flexibility, including:

      • The segment connecting catalytic triad residues

      • The substrate-binding loop

      • The C-terminal region involved in oligomerization

    • This flexibility complicates structural determination and may result in disordered regions in crystal structures

  • Enzyme assay limitations:

    • The hydrophobic nature of the 3-ketodihydrosphingosine substrate creates solubility challenges

    • Direct spectrophotometric assays are complicated by substrate properties

    • Radiometric assays require specialized facilities and safety protocols

  • Functional validation complexities:

    • Complementation studies require appropriate tsc10Δ mutant strains

    • Phenotypic readouts may be subtle or condition-dependent

    • Distinguishing enzyme activity from effects on protein-protein interactions

  • Engineering trade-offs:

    • Modifications that improve expression may compromise function

    • Tags and fusion partners can alter membrane association or oligomerization

    • Codon optimization may influence folding kinetics

Addressing these challenges requires integrated approaches combining protein engineering, optimized expression systems, and sensitive analytical methods tailored to membrane-associated enzymes.

How might A. gossypii TSC10 be leveraged for developing selective antifungal agents?

The unique structural and functional properties of A. gossypii TSC10 present several promising avenues for antifungal development:

  • Exploiting fungal-specific features:

    • The distinct topology of fungal TSC10 compared to mammalian KDSR creates opportunities for selective targeting

    • The dimer interface residues not conserved between fungal and mammalian enzymes offer a selective binding site for inhibitor development

    • The cytosolic orientation of the catalytic domain in fungal TSC10 may allow for differential accessibility of inhibitors

  • Structure-based drug design approaches:

    • Using the crystal structure data from fungal TSC10 homologs to guide rational inhibitor design

    • Focus on compounds that:

      • Interfere with NADPH binding in a fungal-specific manner

      • Disrupt dimerization through binding at non-conserved interface residues

      • Target flexible regions that may be involved in substrate recognition

  • Validation methodologies:

    • Development of high-throughput screening assays specific for A. gossypii TSC10

    • Comparative inhibition studies against mammalian KDSR to establish selectivity

    • Assessment of whole-cell activity against A. gossypii and other pathogenic fungi

    • Evaluation of impact on sphingolipid profiles using lipidomic approaches

  • Combination strategies:

    • Identify synergistic inhibitor combinations targeting multiple points in sphingolipid biosynthesis

    • Explore interactions with existing antifungal agents to enhance efficacy

The critical role of sphingolipids in fungal cell membrane integrity and signaling makes TSC10 an attractive target for novel antifungal development with potentially reduced host toxicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.