Recombinant Ashbya gossypii ADIPOR-like receptor IZH1 (IZH1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
IZH1; AFR337W; ADIPOR-like receptor IZH1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
IZH1
Target Protein Sequence
MSEERGMKEQTISEMAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRETNS VKECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFYLL GAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFVFF STLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAARI QLKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGS YIFICTGKHYSSLLMFI
Uniprot No.

Target Background

Function
ADIPOR-like receptor involved in zinc metabolism. This receptor potentially influences zinc levels by altering membrane sterol content or directly interacting with cellular zinc.
Database Links
Protein Families
ADIPOR family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How is recombinant Ashbya gossypii IZH1 typically expressed for research purposes?

Recombinant Ashbya gossypii IZH1 protein is typically expressed in heterologous systems, with E. coli being a common expression host. The protein is often produced with an N-terminal His-tag to facilitate purification and downstream applications. When expressed in E. coli, the protein is harvested, purified, and typically prepared as a lyophilized powder for storage and distribution .

For optimal research use, the recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant for long-term storage. The reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity .

What is the functional relationship between IZH1 and zinc metabolism in fungal systems?

IZH1 in Ashbya gossypii appears to be functionally related to zinc metabolism based on its homology to similar proteins in related fungi. In Saccharomyces cerevisiae, membrane steroid receptor homologs like IZH1 are involved in metalloregulation, particularly in response to zinc availability . These proteins may function as sensors or transporters that help maintain zinc homeostasis within the cell.

The relationship between IZH1 and zinc is particularly significant in the context of fungal physiology, as zinc is an essential cofactor for numerous proteins. In zinc-deficient conditions, fungi implement various adaptive mechanisms, including the regulation of zinc-dependent proteins and the activation of zinc-sparing pathways . While the specific role of IZH1 in these processes in A. gossypii is not fully characterized in the provided search results, its homology to zinc-responsive proteins in other fungi suggests a potential role in zinc sensing or transport.

How does IZH1 relate to protein secretion pathways in Ashbya gossypii?

Ashbya gossypii has been studied as a model organism for recombinant protein production due to its efficient secretory pathway. Investigations into the A. gossypii secretome have revealed that approximately 1-4% of its proteins are likely to be secreted, with less than 33% of these being putative hydrolases .

While the specific role of IZH1 in the secretory pathway is not directly addressed in the search results, membrane proteins like IZH1 often play crucial roles in cellular responses to secretion stress. Transcriptomic analyses of A. gossypii under recombinant protein secretion conditions and dithiothreitol-induced secretion stress have shown that conventional unfolded protein response (UPR) genes remain unaffected, but other genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, vesicle trafficking, and secretion are upregulated . This suggests a unique stress response mechanism in A. gossypii that might involve membrane receptors like IZH1.

What are the recommended purification strategies for recombinant Ashbya gossypii IZH1?

For recombinant Ashbya gossypii IZH1 with an N-terminal His-tag, the following purification strategy is recommended:

  • Initial Capture: Utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar matrices to capture the His-tagged protein.

  • Buffer Composition: During purification, use Tris/PBS-based buffers at pH 8.0 to maintain protein stability.

  • Purity Assessment: Evaluate protein purity using SDS-PAGE, with a target purity of greater than 90%.

  • Storage Preparation: After purification, the protein should be formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 before lyophilization .

For researchers working with membrane proteins like IZH1, it's important to note that additional detergent-based extraction steps may be necessary prior to affinity purification to effectively solubilize the protein from cellular membranes.

What expression systems are most effective for producing functional recombinant IZH1?

Expression SystemAdvantagesConsiderations
E. coli- Rapid growth
- High yield
- Cost-effective
- Simple genetic manipulation
- Limited post-translational modifications
- Potential inclusion body formation
- Possible toxicity of membrane proteins
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic post-translational modifications
- Better folding of eukaryotic proteins
- Native-like membrane environment
- Slower growth than E. coli
- Potentially lower yields
- More complex media requirements
Insect cells- Advanced eukaryotic post-translational modifications
- Excellent for complex membrane proteins
- Higher cost
- Technical expertise required
- Longer production time
Mammalian cells- Most sophisticated post-translational modifications
- Native-like membrane environment for receptors
- Highest cost
- Most complex system
- Lowest typical yields

The choice of expression system should be guided by the specific research objectives, particularly whether functional activity or high yield is the primary goal.

How does protein secretion stress affect IZH1 function and expression in Ashbya gossypii?

Studies on A. gossypii under secretion stress conditions have revealed an unconventional stress response mechanism. Unlike the typical unfolded protein response (UPR) observed in other organisms, A. gossypii does not show activation of well-known UPR target genes (e.g., IRE1, KAR2, HAC1, and PDI1 homologs) under dithiothreitol-induced secretion stress .

Instead, A. gossypii upregulates genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, vesicle trafficking, vacuolar protein sorting, secretion, and mRNA degradation under these conditions. Concurrently, the transcription of several genes encoding secretory proteins, including components of the glycosylation pathway, is severely repressed .

While the specific regulation of IZH1 under these conditions is not directly addressed in the search results, its function as a membrane receptor may be implicated in the cell's response to secretion stress, potentially as part of the signaling network that coordinates these alternative stress response mechanisms.

What is the relationship between IZH1 and zinc sparing mechanisms in fungal systems?

Fungi have developed sophisticated zinc sparing mechanisms to adapt to zinc-deficient conditions. In Saccharomyces cerevisiae, these mechanisms include:

  • Transcriptional regulation: The zinc-responsive transcription factor Zap1 induces expression of genes needed for zinc homeostasis during deficiency.

  • Protein quality control: Under zinc deficiency, cells accumulate unfolded zinc-dependent proteins that lack their metal cofactor needed for folding and stability. Chaperones like Tsa1 may stabilize zinc apoproteins and shield them from misfolding and aggregation until zinc supplies increase .

  • Alternative enzyme expression: For example, the abundant zinc-binding alcohol dehydrogenases Adh1 and Adh3 are replaced by Adh4, which requires less zinc, through a Zap1-controlled mechanism .

While the specific role of IZH1 in these zinc sparing mechanisms in A. gossypii is not explicitly detailed in the search results, its homology to zinc-responsive membrane proteins suggests it might function in zinc sensing or signaling pathways that coordinate these adaptive responses.

What experimental approaches are recommended for studying IZH1 function in zinc metabolism?

For researchers investigating the function of IZH1 in zinc metabolism, several experimental approaches can be considered:

  • Gene expression analysis: Quantify IZH1 expression under varying zinc concentrations using qRT-PCR or RNA-seq to determine if IZH1 is transcriptionally regulated by zinc availability.

  • Protein localization studies: Use fluorescently-tagged IZH1 to track its subcellular localization under different zinc conditions.

  • Gene deletion/knockdown: Create IZH1 deletion or knockdown strains to assess phenotypic changes in response to zinc deficiency or excess.

  • Zinc uptake assays: Measure zinc uptake or intracellular zinc levels in wild-type versus IZH1-mutant strains using zinc-specific fluorescent probes or atomic absorption spectroscopy.

  • Protein interaction studies: Identify potential interaction partners of IZH1 using co-immunoprecipitation, yeast two-hybrid, or proximity labeling approaches.

  • Transcriptional profiling: Perform RNA-seq analysis comparing wild-type and IZH1-mutant strains under zinc-deficient and zinc-replete conditions to identify genes regulated by IZH1.

How can researchers effectively analyze potential post-translational modifications of recombinant IZH1?

Post-translational modifications (PTMs) of recombinant IZH1 can significantly impact its function and are essential to characterize for comprehensive understanding of the protein. Researchers can employ the following strategies:

  • Mass spectrometry (MS)-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for identification and mapping of specific PTMs

    • Top-down proteomics to analyze intact protein with its modifications

    • Middle-down approaches for analysis of large peptide fragments

  • Site-directed mutagenesis:

    • Mutate potential modification sites and assess functional consequences

    • Create phosphomimetic mutations (e.g., Ser/Thr to Asp/Glu) to study the impact of phosphorylation

  • Specific modification detection:

    • Western blotting with modification-specific antibodies (e.g., anti-phospho, anti-ubiquitin)

    • ProQ Diamond staining for phosphorylation

    • Periodic acid-Schiff staining for glycosylation

  • Bioinformatic prediction tools:

    • Use algorithms to predict potential modification sites based on sequence

    • Compare predictions across different organisms to identify conserved modification sites

For membrane proteins like IZH1, special consideration should be given to sample preparation techniques that preserve the native state of the protein and its modifications.

How does Ashbya gossypii IZH1 compare structurally and functionally to homologous proteins in related fungi?

Ashbya gossypii IZH1 belongs to the ADIPOR-like receptor family, which has homologs in various fungi including Saccharomyces cerevisiae. A comparative analysis might reveal:

  • Structural conservation: The membrane-spanning domains of these proteins are likely highly conserved across fungal species, reflecting their important role in membrane anchoring and potentially in creating binding pockets for ligands or metals.

  • Functional divergence: Despite structural similarities, functional specialization might have occurred during evolution. In S. cerevisiae, membrane steroid receptor homologs are involved in metalloregulation, particularly in response to zinc . The specific function of A. gossypii IZH1 might have diverged to accommodate the unique physiological requirements of this filamentous fungus.

  • Regulation differences: The regulatory mechanisms controlling IZH1 expression might differ between A. gossypii and other fungi. Notably, A. gossypii shows an unconventional response to secretion stress compared to other fungi , which might extend to differences in how IZH1 and its homologs are regulated.

A comprehensive phylogenetic analysis of IZH1 across different fungal species, combined with functional studies, would provide valuable insights into the evolution of this protein family and its diverse functional roles.

What insights from studying IZH1 in Ashbya gossypii can be applied to other fungal systems?

Research on Ashbya gossypii IZH1 can provide broader insights applicable to other fungal systems:

  • Protein secretion mechanisms: A. gossypii has been explored as a host system for recombinant protein production . Understanding how membrane receptors like IZH1 function in this context could inform the development of improved protein production systems in other fungi.

  • Zinc homeostasis strategies: Insights into how A. gossypii regulates zinc homeostasis through proteins like IZH1 could reveal conserved or divergent mechanisms compared to well-studied fungi like S. cerevisiae, enhancing our understanding of metal homeostasis across the fungal kingdom.

  • Stress response pathways: A. gossypii exhibits an unconventional response to secretion stress . Studying how membrane receptors like IZH1 contribute to this response could uncover novel stress adaptation mechanisms potentially present in other fungi.

  • Biotechnological applications: A. gossypii is used for industrial production of riboflavin . Understanding the function of IZH1 could potentially contribute to improved industrial applications of this and other fungi.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.