Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Ashbya gossypii Altered Inheritance of Mitochondria protein 11 (AIM11) is a protein associated with the filamentous fungus Ashbya gossypii . A. gossypii is a hemiascomycete known for its natural ability to produce riboflavin (vitamin B2), making it valuable for industrial production . Research suggests that A. gossypii can also be used as a host for recombinant protein production .

AIM11 Function and Characteristics

The function of the Altered Inheritance of Mitochondria protein 11 (AIM11) in A. gossypii relates to mitochondrial inheritance . Mitochondria are essential organelles responsible for energy production and other critical cellular processes, and their proper distribution during cell division is crucial for maintaining cellular health and function .

Ashbya gossypii as a Host for Recombinant Protein Production

Ashbya gossypii's potential as a host for recombinant protein production has been explored, with studies focusing on improving its secretion capabilities .

Protein Secretion Stress Response in Ashbya gossypii

Research has provided insights into the secretion stress response of A. gossypii, contributing to a basic understanding of its protein secretion potential .

  • Gene Expression Analysis A study investigating the correlation between EGI secretion and gene expression identified 21 genes that were differentially expressed. Among these, 16 were upregulated, and 5 were downregulated in strains secreting recombinant protein .

  • Gene Ontology Enrichment Gene ontology (GO) enrichment analyses indicated a downregulation of translation and an upregulation of ion and amino acid transmembrane transport during EGI secretion .

Actin Cytoskeleton and Hyphal Growth

The Wiskott-Aldrich syndrome-like gene AgWAL1 in A. gossypii is essential for maintaining polarized hyphal growth .

G1 Regulatory Circuit and Nuclear Synchrony

In Ashbya gossypii, sister nuclei from one mitosis rapidly lose synchrony during the subsequent G1 interval. This asynchronous behavior is promoted by a conserved G1 regulatory circuit .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize fulfilling specific tag requests if provided in advance.
Synonyms
AIM11; ABR215C; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
AIM11
Target Protein Sequence
MSLAIIPFITIGWLRCTRKSRDTMSSSPEPQAPMHVTQRQISVFSDEFRQRRRQQMLRFF GATAFTLLSARLAFRGTINRKYVPNMFQLNHRVPLASSQGEALHAFAYGSGLATGGFAML ILGTCWLADVSTVPEFSLRIKALLGESDTQSGRLESAHQDKETRELAAMLDSLLQEKKD
Uniprot No.

Target Background

Database Links
Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it significant for biotechnological applications?

Ashbya gossypii is a filamentous fungus that has long been considered a paradigm of White Biotechnology, particularly for riboflavin (vitamin B2) production. Its industrial relevance has led to the development of significant molecular tools and in silico modeling approaches for its manipulation. Beyond riboflavin, A. gossypii can produce other high-value compounds such as folic acid, nucleosides, and biolipids, making it an important organism for various biotechnological applications .

The increasing knowledge of its genome and metabolism has facilitated the design of effective metabolic engineering strategies not only for optimizing riboflavin production but also for developing new A. gossypii strains for novel biotechnological applications, including recombinant protein production, single cell oils (SCOs), and flavor compounds .

How does the one-vector CRISPR/Cas9 system work for genomic editing in A. gossypii?

The one-vector CRISPR/Cas9 system adapted for A. gossypii contains all required modules for functionality in a single vector. This system comprises:

  • A Cas9 expression module using human codon-optimized Streptococcus pyogenes CAS9 gene under the control of the yeast TEF1 promoter and CYC1 terminator sequences

  • A sgRNA expression module controlled by promoter and terminator sequences from the A. gossypii SNR52 gene (transcribed by RNA polymerase III)

  • A donor DNA (dDNA) module for double-strand break repair via homologous recombination

The sgRNA contains two key sequences: a 20 bp sequence targeting a selected genomic locus and a 79 bp sequence for Cas9 binding. The Cas9 nuclease requires a 5′-NGG-3′ trinucleotide protospacer adjacent motif (PAM) to generate a double-strand break in the genomic target, which can then be repaired with the synthetic mutagenic donor DNA by homologous recombination, thus introducing specifically designed mutations .

What experimental approaches are typically used to study mitochondrial proteins in fungi?

Studying mitochondrial proteins in fungi typically employs multiple complementary approaches:

  • Genetic manipulation techniques: Using CRISPR/Cas9 or other genetic engineering methods to alter gene expression or create knockouts

  • Localization studies: Using fluorescent protein tags to visualize protein localization within mitochondria

  • Mitochondrial isolation and fractionation: Physical separation of mitochondria from other cellular components

  • Proteomics analysis: Mass spectrometry-based identification and quantification of mitochondrial proteins

  • Functional assays: Measuring mitochondrial function (e.g., respiration, membrane potential)

For targeted delivery to mitochondria, researchers use mitochondrial targeting sequences (MTSs). Recent advances include using Variational Autoencoder (VAE), an unsupervised deep learning framework, to design novel MTSs with increased functionality for specific passenger proteins .

How can recombinant AIM11 protein expression be optimized in A. gossypii?

Optimizing recombinant AIM11 protein expression in A. gossypii requires strategic modifications to expression systems and culture conditions. Based on previous research with recombinant proteins in A. gossypii, the following methodology has proven effective:

  • Promoter selection: The native A. gossypii promoters from AgTEF and AgGPD have demonstrated up to 8-fold improvement in recombinant protein production compared to heterologous promoters like ScPGK1. These native promoters should be considered for AIM11 expression .

  • Carbon source optimization: Using glycerol instead of glucose as carbon source has increased recombinant protein production by approximately 1.5-fold. For AIM11 expression, similar carbon source modifications should be evaluated .

  • Expression vector design: Removing terminator sequences with autonomous replicating sequence activity (such as ScADH1 terminator) can improve expression by approximately 2-fold .

  • Integration method: Stable integration of expression cassettes is preferable to episomal expression for consistent long-term production.

  • Secretion signal optimization: For secreted proteins, testing multiple signal sequences can identify optimal export efficiency.

Optimization StrategyPotential ImprovementReference
Native AgTEF/AgGPD promotersUp to 8-fold increase
Glycerol as carbon source~1.5-fold increase
Terminator optimization~2-fold increase
Random mutagenesis of strain~2-fold improvement

What considerations should be made when designing mitochondrial targeting sequences for AIM11 delivery in A. gossypii?

When designing mitochondrial targeting sequences (MTSs) for effective AIM11 delivery in A. gossypii, researchers should consider:

  • Passenger protein influence: The AIM11 protein itself will affect localization efficiency, requiring customized MTS design rather than using generic sequences.

  • Organism-specific import machinery: Fungal mitochondrial import machinery may differ from other eukaryotes, necessitating specialized MTSs that function optimally in A. gossypii.

  • Sequence diversity: Novel MTSs can be designed using Variational Autoencoder (VAE) approaches that have demonstrated success in creating functional targeting sequences with less than 60% sequence identity to natural MTSs while maintaining targeting functionality .

  • Feature preservation: Effective MTSs must maintain key physicochemical properties including:

    • Appropriate amino acid composition (high in positively charged and hydroxylated residues)

    • Amphiphilic α-helical structure potential

    • N-terminal positioning with proper charge distribution

  • Experimental validation: Computational predictions should be validated through fluorescent protein fusion experiments to confirm mitochondrial localization.

Using VAE-based design approaches has shown promise in generating diverse, functional MTSs that can enhance delivery efficiency by addressing protein-specific targeting challenges .

What experimental controls are essential when analyzing AIM11 function in mitochondrial inheritance?

When analyzing AIM11 function in mitochondrial inheritance, several critical experimental controls must be implemented to ensure data validity:

  • Wild-type control: Unmodified A. gossypii with normal AIM11 expression to establish baseline mitochondrial inheritance patterns.

  • Complete knockout control: A strain with complete AIM11 deletion to determine the full impact of its absence.

  • Complementation control: AIM11 knockout strains complemented with functional AIM11 to verify phenotype rescue.

  • Point mutation controls: Strains expressing AIM11 with specific point mutations in functional domains to identify critical residues.

  • Expression level controls: Strains with varying levels of AIM11 expression to assess dose-dependency.

  • Localization controls: Verification that modified AIM11 proteins properly localize to mitochondria using fluorescent tagging or subcellular fractionation.

  • Blind analysis design: Data should be analyzed by researchers unaware of sample identity to prevent bias, especially when evaluating qualitative aspects of mitochondrial inheritance3.

Experimental error must be minimized by collecting quantitative rather than qualitative data, running multiple samples per condition, and repeating experiments to address potential sampling errors3.

How can CRISPR/Cas9 be applied for marker-free engineering of AIM11 in A. gossypii?

The one-vector CRISPR/Cas9 system for A. gossypii enables marker-free engineering of AIM11 through the following methodological approach:

  • Design of targeting sgRNA: Create a sgRNA targeting the AIM11 gene locus with a 20 bp sequence complementary to the target site, ensuring a PAM sequence (5'-NGG-3') is present immediately downstream.

  • Construction of repair template: Design donor DNA (dDNA) containing the desired modification flanked by homology arms (~40-60 bp) matching sequences upstream and downstream of the cut site.

  • Vector assembly: Insert the sgRNA module and dDNA repair template into the one-vector CRISPR/Cas9 system containing the Cas9 expression cassette.

  • Transformation: Transform A. gossypii spores with the assembled vector using standard electroporation or chemical transformation protocols.

  • Screening: Identify transformants using phenotypic screening or PCR genotyping, without requiring selectable markers in the final strain.

  • Confirmation: Verify the intended modification through sequencing and functional assays.

This marker-free approach enables precise genomic modifications without introducing antibiotic resistance genes or other selection markers, facilitating multiple consecutive edits and maintaining the native genetic context of the AIM11 gene .

What approaches can resolve contradictory data regarding AIM11 localization in A. gossypii?

When faced with contradictory data regarding AIM11 localization in A. gossypii, researchers should employ the following systematic approach to resolve discrepancies:

  • Methodological validation: Compare different localization techniques:

    • Fluorescent protein tagging at both N- and C-termini

    • Immunofluorescence with specific antibodies

    • Subcellular fractionation followed by Western blotting

    • Proximity labeling approaches (BioID or APEX)

  • Tag interference assessment: Determine if protein tags disrupt natural localization by:

    • Testing multiple tag sizes and types

    • Implementing tag-free approaches (antibody detection)

    • Conducting functional complementation tests with tagged proteins

  • Strain background comparison: Test localization in multiple strain backgrounds to identify genetic modifiers.

  • Growth condition variation: Examine localization under different growth conditions that might trigger relocalization:

    • Log vs. stationary phase

    • Different carbon sources

    • Stress conditions

    • Cell cycle stages

  • Statistical rigorous analysis: Quantify localization patterns across large numbers of cells (>100 per condition) and analyze data in a blind fashion to prevent bias3.

  • Multi-laboratory validation: Have independent laboratories reproduce key findings using standardized protocols.

This systematic approach follows sound experimental design principles by identifying potential sources of variability and bias, ensuring measurement accuracy, and seeking independent verification of results3.

How can heterologous expression systems be compared for optimal AIM11 production in A. gossypii?

To systematically compare heterologous expression systems for optimal AIM11 production in A. gossypii, the following methodological framework should be implemented:

  • Vector design comparison:

    • Test multiple vector backbones (integrative vs. replicative)

    • Compare different selectable markers

    • Evaluate various integration loci for chromosomal integration

  • Promoter strength evaluation:

    • Quantitatively measure expression levels from different promoters

    • Test constitutive promoters (AgTEF, AgGPD) vs. inducible systems

    • Analyze promoter performance under different growth conditions

  • Expression cassette optimization:

    • Compare various terminator sequences

    • Test different 5' and 3' UTR configurations

    • Evaluate codon optimization strategies for AIM11

  • Standardized production assessment:

    • Measure protein yield using quantitative Western blotting

    • Assess protein activity/functionality

    • Determine protein stability and turnover rates

Expression System ComponentOptions to CompareMeasurement Parameters
PromotersAgTEF, AgGPD, ScPGK1Protein yield, expression timing
Vector TypeIntegrative, ReplicativeStability, copy number
Codon OptimizationNative, OptimizedTranslation efficiency, mRNA stability
Carbon SourceGlucose, GlycerolProtein yield, growth rate

Previous research with recombinant proteins in A. gossypii demonstrated that native promoters (AgTEF, AgGPD) outperformed heterologous promoters like ScPGK1 by up to 8-fold. Additionally, using glycerol instead of glucose as carbon source increased recombinant protein production by approximately 1.5-fold .

For each expression system, the independent variable (vector/promoter type) should be clearly defined, while the dependent variable (protein production level) must be measured using consistent, quantitative methods to minimize measurement error and bias3.

How can mitochondrial isolation be optimized for studying AIM11 in A. gossypii?

Optimizing mitochondrial isolation from A. gossypii for AIM11 research requires addressing the unique challenges presented by this filamentous fungus:

  • Cell wall disruption optimization:

    • Enzymatic digestion using a combination of glucanases and chitinases

    • Mechanical disruption using glass beads or high-pressure homogenization

    • Pressure-based disruption using French press or cell disruptors

  • Differential centrifugation protocol:

    • Initial low-speed centrifugation (1,000-2,000 × g) to remove cell debris

    • Medium-speed centrifugation (5,000-12,000 × g) to collect mitochondria

    • High-speed ultracentrifugation for further purification if needed

  • Density gradient purification:

    • Percoll gradients (20-40%) for general mitochondrial isolation

    • Sucrose gradients (0.8-1.5 M) for higher purity

    • Nycodenz gradients for specialized applications

  • Contamination control measures:

    • Addition of protease inhibitors to prevent protein degradation

    • Implementation of steps to minimize other organelle contamination

    • Verification of mitochondrial enrichment using marker proteins

  • Functional preservation:

    • Optimization of buffer composition (pH, ionic strength)

    • Maintenance of appropriate temperature throughout isolation

    • Addition of substrates to maintain membrane potential if needed

Each isolation method should be evaluated based on yield, purity, structural integrity, and functional activity of isolated mitochondria. The optimal protocol may vary depending on the specific downstream application (protein analysis, functional studies, or structural examination).

What strategies can overcome challenges in detecting low-abundance AIM11 in A. gossypii mitochondria?

Detecting low-abundance AIM11 in A. gossypii mitochondria presents significant technical challenges that can be addressed through the following approaches:

  • Sample enrichment techniques:

    • Subcellular fractionation to isolate mitochondria

    • Immunoprecipitation of AIM11 and associated proteins

    • Density gradient ultracentrifugation for further purification

    • Affinity purification using tagged AIM11 variants

  • Sensitive detection methods:

    • Western blotting with enhanced chemiluminescence (ECL)

    • Fluorescent secondary antibodies for quantitative detection

    • Mass spectrometry with targeted selected reaction monitoring (SRM)

    • Proximity ligation assay for in situ detection

  • Signal amplification strategies:

    • Tyramide signal amplification for immunofluorescence

    • Multiple epitope tags for enhanced detection

    • Enzymatic amplification systems for western blot detection

    • Tandem mass tag (TMT) labeling for MS-based quantification

  • Instrumentation optimization:

    • Use of high-sensitivity detectors (EM-CCD cameras, PMTs)

    • Extended exposure times balanced against background signal

    • Signal averaging across multiple measurements

    • Advanced noise reduction algorithms

  • Experimental controls:

    • Overexpression controls to verify detection methods

    • Knockout controls to confirm signal specificity

    • Spike-in standards for quantification

    • Technical replicates to establish detection limits

These approaches should be implemented systematically, with careful attention to experimental design principles to minimize bias and measurement error3. Quantitative rather than qualitative assessments are preferable, and techniques should be validated using known controls before application to experimental samples.

How might combining CRISPR/Cas9 with mitochondrial targeting sequences advance AIM11 research in A. gossypii?

The integration of CRISPR/Cas9 genome editing with advanced mitochondrial targeting sequence (MTS) design offers powerful new approaches for AIM11 research in A. gossypii:

  • Precision engineering of native AIM11:

    • Introduction of point mutations to identify functional domains

    • Creation of deletion variants to map protein interaction regions

    • Addition of regulatory elements to control expression levels

    • Generation of conditional alleles for temporal studies

  • Advanced localization studies:

    • Creation of fusion proteins with optimized MTSs for improved mitochondrial targeting

    • Implementation of dual-targeting sequences for studying compartmentalization

    • Development of inducible localization systems for dynamic studies

    • Engineering of domain-swapped variants to identify localization signals

  • Functional genomics applications:

    • Systematic mutation of AIM11 interaction partners identified through proteomics

    • Creation of reporter strains to monitor AIM11 activity in vivo

    • Engineering of synthetic genetic interaction networks

    • Introduction of orthologous AIM11 variants from related species

The one-vector CRISPR/Cas9 system for A. gossypii enables marker-free engineering , which can be combined with VAE-designed mitochondrial targeting sequences to create sophisticated experimental systems. This approach allows for multiple consecutive genomic modifications without accumulating selection markers, facilitating complex genetic engineering projects.

What potential role might AIM11 play in metabolic engineering applications using A. gossypii?

AIM11, as a mitochondrial protein involved in organelle inheritance, may have significant implications for metabolic engineering applications in A. gossypii:

  • Biofuel and bioproduct optimization:

    • Modulation of mitochondrial content could enhance respiratory capacity

    • Altered mitochondrial inheritance patterns might stabilize production strains

    • Engineering AIM11 expression levels could optimize energy metabolism for specific products

  • Riboflavin production enhancement:

    • Given A. gossypii's established role in riboflavin production , AIM11 modifications might improve yields through:

      • Enhanced mitochondrial function supporting precursor synthesis

      • Improved mitochondrial distribution during growth phases

      • Optimized redox balance through regulated mitochondrial activity

  • Recombinant protein production:

    • Engineered AIM11 could enhance protein expression by:

      • Improving energy availability for protein synthesis

      • Enhancing cellular stress resistance through mitochondrial modulation

      • Supporting post-translational modifications requiring mitochondrial function

  • Single-cell oil production:

    • A. gossypii has potential for single-cell oil (SCO) production

    • AIM11 engineering could:

      • Alter lipid metabolism through mitochondrial function regulation

      • Enhance fatty acid synthesis pathways linked to mitochondrial metabolism

      • Improve growth characteristics while maintaining high lipid accumulation

A. gossypii strains with engineered AIM11 could be developed using the marker-free CRISPR/Cas9 system , allowing multiple genetic modifications to be introduced without accumulating selection markers. This would facilitate the creation of industrial strains with precisely tuned mitochondrial properties optimized for specific biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.