Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCF1; AIM31; AER310W; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
RCF1
Target Protein Sequence
MSYLPTSSEADKDLDEMTFSEKMVFHCKREPLVPAGVLMTTGAILLAIKNVRSGNRRNAQ KWFRWRVGLQTGTLVALIAGSFFYGSAKHEQLSKEEQLRQKAKMREQLWIQELERRDLEV RRRKQRAEEARKKAAEMQSELSGLEQELRELEESRRK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii AIM31 and what is its fundamental role in mitochondrial function?

AIM31, now known as Rcf1 (Respiratory supercomplex factor 1), is a protein originally identified in a screen designed to discover genes encoding proteins whose absence caused altered inheritance of mitochondrial DNA (mtDNA) in the filamentous fungus Ashbya gossypii. This protein belongs to the conserved hypoxia-induced gene 1 (Hig1) protein family and plays a crucial role in mitochondrial respiratory function .

Rcf1/AIM31 functions as a component of the cytochrome bc1-COX supercomplex in the mitochondrial respiratory chain. Analysis of the protein's interactions reveals that it associates with both aspects of this supercomplex—binding to both the cytochrome bc1 and cytochrome c oxidase (COX) enzyme domains, with a particularly strong association with the Cox3 protein within the COX complex . The protein is essential for proper assembly and stabilization of respiratory chain supercomplexes, contributing to mitochondrial oxidative phosphorylation and energy production.

How does AIM31/Rcf1 interact with other mitochondrial components in A. gossypii?

AIM31/Rcf1 functions in concert with another mitochondrial protein, AIM38 (renamed Rcf2), which shares limited similarity to AIM31 and other Hig1 proteins. These proteins independently bind to the cytochrome bc1-COX supercomplex and exhibit functional overlap . Experimental evidence indicates that both proteins may act as structural bridges that support the assembly and stability of respiratory supercomplexes.

The interaction pattern has been characterized through affinity purification experiments using histidine-tagged cytochrome c1 and Aac2 derivatives under mild solubilization conditions (digitonin) that maintain supercomplex organization. These analyses confirmed that Rcf1 physically associates with the cytochrome bc1-COX-AAC supercomplex . Notably, Rcf1 displays a close physical relationship with the Cox3 protein within the COX complex, suggesting specific protein-protein interactions critical for function.

What phenotypic changes occur in A. gossypii when AIM31/Rcf1 is deleted?

  • Cytochrome c oxidase (COX) enzyme activity

  • Assembly of peripheral COX subunits, particularly Cox12 and Cox13

  • Proper formation of the cytochrome bc1-COX supercomplex

Additionally, studies in heterokaryon mutants with mixed nuclei (some with deletions of mitochondrial fusion/fission genes and some wild type) demonstrate that alterations in mitochondrial dynamics genes can lead to severe growth and sporulation defects in A. gossypii . While not directly examining AIM31, these studies provide context for understanding how disruptions in mitochondrial protein functions impact the organism.

What methodologies are most effective for investigating AIM31/Rcf1 function in A. gossypii?

Several complementary approaches have proven effective for studying AIM31/Rcf1 function:

Biochemical Characterization:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to visualize intact respiratory supercomplexes and their components

  • Affinity purification using histidine-tagged respiratory complex components to identify interacting partners

  • Mass spectrometry analysis for protein identification and characterization of post-translational modifications

Genetic Manipulation:

  • Gene deletion studies, particularly examining the effects of single versus double deletions (AIM31/Rcf1 and AIM38/Rcf2)

  • CRISPR-Cpf1 technology for multiplex genome editing, which facilitates efficient genetic manipulation in A. gossypii

  • Creation of heterokaryon mutants with mixed nuclei to study gene function in multinucleate contexts

Functional Assays:

  • Measurement of cytochrome c oxidase activity to assess respiratory function

  • Transcriptomic analysis to identify gene expression changes under various conditions

  • Two-dimensional gel electrophoresis for secretome analysis, providing insights into cellular responses to protein modifications

How does secretion stress impact mitochondrial function and potentially AIM31/Rcf1 in A. gossypii?

Investigations into secretion stress in A. gossypii have revealed unexpected responses that differ from conventional unfolded protein response (UPR) patterns observed in other fungi. When A. gossypii cells are subjected to dithiothreitol-induced secretion stress or recombinant protein secretion conditions, transcriptomic analyses demonstrate that:

  • Conventional UPR gene targets (e.g., IRE1, KAR2, HAC1, and PDI1 homologs) remain unaffected, indicating the absence of a typical UPR activation

  • Alternative stress response pathways are activated, involving:

    • Upregulation of genes related to protein unfolding

    • Endoplasmic reticulum-associated degradation

    • Proteolysis

    • Vesicle trafficking

    • Vacuolar protein sorting

    • Secretion

    • mRNA degradation

  • Transcription of several genes encoding secretory proteins, including components of the glycosylation pathway, is severely repressed

While these studies don't specifically examine AIM31/Rcf1, they provide critical context for understanding how A. gossypii responds to cellular stress, which may indirectly affect mitochondrial function and respiratory complex assembly.

What is currently known about the secretome of A. gossypii and its relationship to mitochondrial function?

The secretome of A. gossypii has been characterized through computational predictions and experimental verification using two-dimensional gel electrophoresis of proteins secreted into culture supernatants. Key findings include:

  • Approximately 1-4% of A. gossypii proteins are likely secreted via the general secretory pathway

  • Less than 33% of secreted proteins are putative hydrolases

  • Most secreted proteins exhibit an isoelectric point between 4 and 6, with molecular masses above 25 kDa

  • Secreted protein profiles differ between minimal and rich medium conditions

While no direct relationship between the secretome and AIM31/Rcf1 function has been established, the characterization of secretory pathways provides insights into cellular processes that may indirectly influence mitochondrial function. For example, proteins involved in cellular energy metabolism, stress responses, or redox balance could affect mitochondrial performance and potentially interact with respiratory complex assembly factors like AIM31/Rcf1.

How can CRISPR-Cpf1 technology be optimized for multiplex editing of AIM31/Rcf1 and related genes in A. gossypii?

CRISPR-Cpf1 technology represents a significant advancement for genetic manipulation in A. gossypii, offering advantages over CRISPR-Cas9 for certain applications. The Cpf1 nuclease from Lachnospiraceae bacterium utilizes a T-rich PAM sequence (5'-TTTN-3'), expanding the range of targetable genomic loci compared to Cas9's requirement for a 5'-NGG-3' PAM .

For optimal multiplex editing of AIM31/Rcf1 and related genes, researchers should consider:

Target Site Selection:

  • Identify suitable TTTN PAM sites in and around the AIM31/Rcf1 gene

  • Design multiple guide RNAs for simultaneous targeting of AIM31/Rcf1 and functionally related genes (e.g., AIM38/Rcf2)

  • Evaluate potential off-target sites using in silico prediction tools

Experimental Design:

  • The CRISPR-Cpf1 system has been validated in A. gossypii for introducing large deletions with various auxotrophic markers (HIS3, ADE2, TRP1, LEU2, and UR)

  • For precise modification of AIM31/Rcf1, design repair templates containing desired mutations flanked by homology arms

  • When studying the interaction between AIM31/Rcf1 and AIM38/Rcf2, consider simultaneous targeting to create double knockouts or introduce tagged versions of both proteins

Validation Methods:

  • PCR screening and sequencing to confirm successful editing

  • Functional assays, including measurement of cytochrome c oxidase activity

  • BN-PAGE to assess effects on respiratory supercomplex assembly

What insights can the study of heterokaryons provide about AIM31/Rcf1 function in multinucleate A. gossypii?

A. gossypii is a multinucleate filamentous fungus where nuclei divide asynchronously within a common cytoplasm. This unique characteristic offers opportunities to study gene function through heterokaryons—cells containing a mixture of nuclei with different genotypes.

Research with heterokaryon mutants has demonstrated that:

  • Mitochondria exhibit substantial heterogeneity in morphology and membrane potential within a single multinucleated cell

  • Heterokaryon mutants with mixed nuclei (some containing deletions in mitochondrial fusion/fission genes DNM1 and FZO1, others wild type) show altered mitochondrial morphology and severe growth and sporulation defects

  • These dominant phenotypic effects suggest that certain gene products may be required locally near their expression site rather than diffusing widely throughout the cell

For AIM31/Rcf1 research, heterokaryon approaches could reveal:

  • Whether AIM31/Rcf1 function is localized to specific subcellular domains

  • How nuclear asynchrony affects the expression and function of mitochondrial proteins

  • The spatial organization of respiratory complex assembly in multinucleate cells

How does the evolutionary conservation of AIM31/Rcf1 across fungal species inform its functional importance?

AIM31/Rcf1 belongs to the conserved hypoxia-induced gene 1 (Hig1) protein family, which is found across diverse eukaryotes . This evolutionary conservation suggests fundamental importance in mitochondrial function.

Comparative analysis reveals:

  • In Saccharomyces cerevisiae, the Aim31 protein displays a high degree of similarity to members of the Hig1 protein family

  • The conservation of this protein family across species suggests a critical role in respiratory function that has been maintained throughout evolutionary history

  • Functional studies in different fungi can provide insights into both conserved and species-specific aspects of AIM31/Rcf1 function

Research questions to explore include:

  • How do sequence variations in AIM31/Rcf1 homologs correlate with differences in respiratory metabolism across fungal species?

  • Are there structural motifs within AIM31/Rcf1 that are absolutely conserved and likely critical for function?

  • How does the interaction network of AIM31/Rcf1 vary between filamentous fungi like A. gossypii and unicellular yeasts like S. cerevisiae?

What are the implications of AIM31/Rcf1 function for recombinant protein production in A. gossypii?

A. gossypii has been explored as a host system for recombinant protein production, with several characteristics making it attractive for biotechnology applications . Understanding AIM31/Rcf1 function in this context could have important implications:

Metabolic Engineering Considerations:

  • Since AIM31/Rcf1 affects respiratory chain function, its manipulation might influence cellular energy metabolism and consequently recombinant protein production efficiency

  • The protein's role in mitochondrial function could affect cellular responses to the metabolic demands of high-level protein expression

Stress Response Optimization:

  • A. gossypii displays an unconventional response to secretion stress, lacking typical UPR activation

  • Understanding how mitochondrial function and specifically AIM31/Rcf1 contribute to cellular stress responses could inform strategies for improving recombinant protein yields

Table 1: Comparative Analysis of Key Proteins in Mitochondrial Function and Their Impact on Recombinant Protein Production

ProteinOriginal IdentificationRenamed AsFunctionImpact on Recombinant Production
AIM31Altered inheritance of mtDNARcf1Respiratory supercomplex assemblyPotential influence on energy metabolism
AIM38Altered inheritance of mtDNARcf2Respiratory supercomplex assemblyRedundant function with Rcf1
DNM1Mitochondrial fission-Mitochondrial morphologySevere growth defects when altered
FZO1Mitochondrial fusion-Mitochondrial morphologyImpacts cell growth and sporulation

What are the most effective protocols for purifying and characterizing AIM31/Rcf1 from A. gossypii?

Effective purification and characterization of AIM31/Rcf1 from A. gossypii can be achieved through a combination of techniques:

Protein Purification Strategy:

  • Epitope tagging of AIM31/Rcf1 (histidine or other affinity tags) through genomic integration

  • Growth of A. gossypii in appropriate medium to achieve optimal expression

  • Cell harvesting and mitochondrial isolation through differential centrifugation

  • Solubilization of mitochondrial membranes using mild detergents (digitonin is preferred to maintain supercomplex integrity)

  • Affinity chromatography to isolate AIM31/Rcf1 and associated proteins

  • Optional additional purification steps (ion exchange, size exclusion) for higher purity

Characterization Methods:

  • Mass spectrometry for protein identification and analysis of post-translational modifications

  • Blue native gel electrophoresis to assess native protein complexes

  • Western blotting with specific antibodies to confirm identity and quantity

  • Functional reconstitution assays to assess activity in artificial membrane systems

This methodological approach has been successfully used to demonstrate that AIM31/Rcf1 associates with the cytochrome bc1-COX supercomplex, with particularly strong binding to the COX complex domain and close physical relationship to the Cox3 protein .

How can transcriptomic analysis be applied to understand AIM31/Rcf1 regulation and function?

Transcriptomic analysis provides valuable insights into gene expression patterns and regulatory networks affecting AIM31/Rcf1. Based on successful approaches with A. gossypii under secretion stress conditions , the following methodology can be applied:

Experimental Design:

  • Culture A. gossypii under various conditions (different carbon sources, oxygen levels, stress conditions)

  • Include AIM31/Rcf1 deletion strains and appropriate controls

  • Harvest cells at multiple time points to capture dynamic responses

RNA Preparation and Analysis:

  • Extract high-quality total RNA following established protocols

  • Perform RNA sequencing (RNA-Seq) using current high-throughput platforms

  • Analyze data using bioinformatics pipelines for differential expression analysis

  • Focus particularly on genes involved in:

    • Mitochondrial function and biogenesis

    • Respiratory chain components

    • Stress response pathways

    • Energy metabolism

Validation and Integration:

  • Confirm key findings with quantitative PCR

  • Correlate transcriptomic changes with phenotypic observations

  • Integrate with proteomics data when available

  • Use network analysis to identify regulatory hubs and pathways

Previous transcriptomic studies in A. gossypii have successfully identified unexpected stress response patterns, including the absence of conventional unfolded protein response activation under secretion stress . Similar approaches could reveal novel aspects of AIM31/Rcf1 regulation and function.

What are the most promising avenues for advancing our understanding of AIM31/Rcf1 function in A. gossypii?

Several promising research directions could significantly advance our understanding of AIM31/Rcf1:

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of AIM31/Rcf1 through X-ray crystallography or cryo-electron microscopy

    • Map the interaction surfaces with respiratory chain components

    • Identify structural motifs critical for function through mutagenesis

  • Systems Biology Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of respiratory complex assembly

    • Analyze the impact of AIM31/Rcf1 on global cellular metabolism

    • Develop computational models predicting the effects of AIM31/Rcf1 manipulation

  • Advanced Imaging Techniques:

    • Apply super-resolution microscopy to visualize AIM31/Rcf1 localization within mitochondria

    • Use live-cell imaging to monitor dynamic changes in protein distribution

    • Investigate potential heterogeneity in protein distribution across the multinucleate syncytium

  • Biotechnological Applications:

    • Explore the potential of AIM31/Rcf1 engineering to enhance recombinant protein production

    • Investigate whether manipulation of respiratory complex assembly can improve cellular energy metabolism for biotechnological applications

    • Develop AIM31/Rcf1-based sensors for monitoring mitochondrial function in industrial strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.