Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
AIM36; FMP39; ADR282C; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-221
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
AIM36
Target Protein Sequence
ASKAPGSEDLPSAWKMVGVAVVSTLIFVQAAKSIDRSKPQTEFSEAEFEKVRSGLRRRVT VFKPDELEVLAVLADVPVEKIRAPAGARAVRVQQALERFRTDEHDKYHALLEELHAVHGD DYSAHLPKGALVALMGRYLKEVCQAGDSVVLLGFPRNMQEAIQFESEVAVISALVAPQGS EESQLVQYFKTVNKVITV
Uniprot No.

Target Background

Database Links
Protein Families
AIM36 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is AIM36 and what is its biological function in Ashbya gossypii?

AIM36 (Altered inheritance of mitochondria protein 36, mitochondrial), also known as FMP39 with ordered locus name ADR282C, is a mitochondrial protein found in the filamentous fungus Ashbya gossypii . While the complete functional characterization remains an active area of research, AIM36 appears to be involved in mitochondrial inheritance processes, as suggested by its name. A. gossypii is a riboflavin-producing filamentous fungus closely related to unicellular yeasts such as Saccharomyces cerevisiae . This evolutionary relationship makes AIM36 particularly interesting for comparative studies of mitochondrial inheritance mechanisms between filamentous fungi and yeasts.

What are the optimal expression systems for recombinant AIM36 production?

Recombinant AIM36 can be successfully expressed in both prokaryotic (E. coli) and eukaryotic (yeast) expression systems . For E. coli expression, the protein is typically fused with N-terminal His-tag to facilitate purification . The choice between expression systems depends on the research application:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigher yield, simpler culture conditions, cost-effectivePotential improper folding, lacks post-translational modificationsStructural studies, antibody production
YeastNative-like folding, post-translational modificationsLower yield, more complex culture conditionsFunctional studies, protein-protein interaction analyses

For functional studies that require post-translational modifications, yeast expression systems may provide a more physiologically relevant protein product .

What purification protocol yields the highest purity and activity for recombinant AIM36?

A multi-step purification protocol typically yields the highest purity (>90%) for recombinant AIM36:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged protein

  • Size exclusion chromatography to remove aggregates and contaminants

  • Optional ion-exchange chromatography for highest purity requirements

The purified protein should be maintained in Tris-based buffer with 50% glycerol at pH 8.0 for optimal stability . SDS-PAGE analysis should confirm purity of >85-90% for most research applications .

What are the optimal storage conditions for maintaining AIM36 stability and activity?

For long-term storage of recombinant AIM36:

  • Store lyophilized powder at -20°C/-80°C for up to 12 months

  • For reconstituted protein, add glycerol to a final concentration of 50% and store at -20°C/-80°C for up to 6 months

  • Working aliquots can be maintained at 4°C for up to one week

Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity . For applications requiring maximum activity, fresh reconstitution from lyophilized stocks is recommended.

What reconstitution methods ensure optimal protein solubility and activity?

To properly reconstitute lyophilized AIM36:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution at room temperature with gentle mixing, avoiding vortexing

  • For long-term storage, add glycerol to 5-50% final concentration and aliquot to avoid freeze-thaw cycles

This methodology preserves the structural integrity and functional characteristics of the protein for subsequent experimental applications.

How can AIM36 be utilized in mitochondrial inheritance studies in filamentous fungi?

AIM36 serves as a valuable tool for investigating mitochondrial dynamics in filamentous fungi. A methodological approach includes:

  • Expression system development: Utilize the dual luciferase reporter assay system adapted for A. gossypii to study AIM36 expression under different conditions . The system employs integrative cassettes containing:

    • Recombinogenic flanks targeting specific loci

    • Marker genes (e.g., loxP-KanMX-loxP)

    • Promoter sequences of interest

    • Reporter luciferase coding sequences

    • Terminator sequences

  • Localization studies: Use fluorescently-tagged AIM36 to track protein distribution during mitochondrial inheritance through confocal microscopy.

  • Gene disruption analysis: Create AIM36 knockout strains using CRISPR-Cas9 or traditional homologous recombination approaches to assess the impact on mitochondrial distribution during hyphal growth in A. gossypii.

  • Protein interaction studies: Employ co-immunoprecipitation or proximity labeling techniques to identify AIM36 interaction partners in the mitochondrial inheritance pathway.

These approaches leverage A. gossypii as a model for fungal developmental biology, particularly relevant for understanding the functional differences between filamentous growth and yeast growth .

What techniques can be employed to identify protein interaction partners of AIM36?

Identifying AIM36 interaction partners requires a multi-faceted approach:

  • Affinity purification-mass spectrometry (AP-MS): Using recombinant His-tagged AIM36 as bait to capture interacting proteins from A. gossypii mitochondrial extracts, followed by mass spectrometry identification.

  • Proximity-dependent biotin identification (BioID): Fusion of a biotin ligase to AIM36 allows biotinylation of proximal proteins, which can then be purified and identified.

  • Yeast two-hybrid screening: Although traditional Y2H may not be optimal for mitochondrial proteins, modified membrane-based two-hybrid systems can be employed.

  • Co-immunoprecipitation with targeted candidates: Based on pathway predictions, co-IP can validate specific protein-protein interactions.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by MS analysis can capture transient or weak interactions that might be missed by other methods.

These techniques should be complemented with bioinformatic analyses to predict functional networks based on known mitochondrial inheritance pathways in related fungi.

How does AIM36 from A. gossypii compare to homologous proteins in other fungi?

Comparative analysis of AIM36 across fungal species provides insights into evolutionary conservation and functional divergence:

SpeciesProtein HomologSequence Identity (%)Functional Similarities/Differences
Saccharomyces cerevisiaeAIM36/FMP39~70%Similar mitochondrial localization but potentially different roles in unicellular vs. filamentous contexts
Candida albicansPutative homolog~55%May play a role in morphological switching relevant to pathogenicity
Kluyveromyces lactisPredicted AIM36-like~65%Similar industrial applications but different riboflavin production capacity

This comparative approach is particularly valuable given that A. gossypii is closely related to unicellular yeasts such as S. cerevisiae, making it an excellent model to elucidate regulatory networks governing functional differences between filamentous growth and yeast growth .

What evolutionary insights can be gained from studying AIM36 across different fungal species?

Evolutionary analysis of AIM36 can provide significant insights into mitochondrial inheritance adaptations:

  • Sequence alignment and phylogenetic analysis reveal conserved domains essential for core functions versus variable regions that may confer species-specific adaptations.

  • The study of selection pressures on different protein domains can identify regions under positive selection, potentially indicating functional innovation.

  • Comparative analysis between unicellular and filamentous fungi can elucidate how mitochondrial inheritance mechanisms have adapted to different growth morphologies.

  • Correlation of AIM36 sequence variations with differences in mitochondrial dynamics across species can reveal structure-function relationships.

This evolutionary perspective is particularly relevant considering recent advances in understanding human mitochondrial inheritance , as fundamental mechanisms may be conserved across eukaryotes despite divergent details.

What experimental approaches can determine the precise role of AIM36 in mitochondrial function?

Several complementary methods can elucidate AIM36's specific role:

  • CRISPR-Cas9 genome editing: Generate precise mutations or deletions in the AIM36 gene to assess phenotypic consequences. The recent development of mitochondrial genome editing tools, including TALEDs (transcription activator-like effector-linked deaminases) that can perform adenine-to-guanine base conversions, provides new approaches for studying mitochondrial proteins .

  • Metabolic flux analysis: Using 13C-labeled substrates to trace metabolic pathways in wild-type versus AIM36-mutant strains can reveal the impact on mitochondrial metabolism .

  • High-resolution microscopy: Techniques such as super-resolution microscopy or electron tomography can visualize AIM36's precise localization within mitochondrial substructures.

  • Mitochondrial isolation and fractionation: Determine the submitochondrial localization (outer membrane, intermembrane space, inner membrane, or matrix) through biochemical fractionation.

  • In vitro reconstitution: Using purified components to reconstruct specific mitochondrial processes can test direct functional roles of AIM36.

These approaches should be integrated with phenotypic characterization of A. gossypii strains with modified AIM36 expression to correlate molecular functions with cellular outcomes.

How can gene expression systems be optimized for studying AIM36 function in A. gossypii?

Optimizing gene expression systems for AIM36 functional studies requires:

  • Promoter selection: The dual luciferase reporter assay has identified several promoters with different strengths in A. gossypii, including:

    • Strong promoters: PCCW12, PSED1

    • Medium/weak promoters: PTSA1, PHSP26, PAGL366C, PTMA10, PCWP1, PAFR038W, PPFS1

  • Expression vector design: For functional studies, integrative cassettes are preferred over episomal vectors due to the multinucleated syncytium nature of A. gossypii and plasmid stability issues .

  • Selection marker strategy: Using recyclable markers such as loxP-kanMX-loxP with Cre recombinase allows sequential genetic modifications .

  • Inducible systems: Developing carbon source-regulatable promoters enables controlled expression for temporal studies of AIM36 function .

  • Validation methods: Quantitative assessment of expression levels through RT-qPCR or Western blotting ensures consistent expression across experiments.

This methodological framework enables precise control over AIM36 expression, essential for detailed functional characterization.

How might understanding AIM36 contribute to metabolic engineering of A. gossypii for biotechnological applications?

Understanding AIM36's role in mitochondrial function could advance A. gossypii as a biotechnological platform:

  • Enhanced riboflavin production: As A. gossypii is industrially exploited for riboflavin production , optimizing mitochondrial function through AIM36 engineering could improve precursor availability and energy metabolism for riboflavin biosynthesis.

  • Biolipid production: A. gossypii has been explored for single cell oil (SCO) production . Given that mitochondria interface closely with lipid metabolism, AIM36 modifications could potentially enhance lipid accumulation or alter fatty acid profiles.

  • Metabolic flux optimization: Knowledge of AIM36's impact on mitochondrial function could inform strategies to redirect carbon flux toward desired products through targeted genetic interventions .

  • Stress resistance engineering: If AIM36 affects mitochondrial stress responses, its modification could enhance A. gossypii's robustness in industrial fermentation conditions.

These applications align with the expanding biotechnological potential of A. gossypii beyond its traditional role in riboflavin production .

What analytical methods can assess the impact of AIM36 modifications on mitochondrial metabolism in A. gossypii?

To evaluate how AIM36 modifications affect mitochondrial metabolism:

  • 13C metabolic flux analysis: Using 13C-labeled substrates (such as 13C-labeled yeast extract, a key medium component) coupled with MS and NMR techniques allows quantification of intracellular fluxes . This approach has revealed that during growth, A. gossypii exhibits:

    • High TCA cycle activity

    • Low flux through gluconeogenesis

    • Low flux through pentose phosphate pathway

  • Respirometry: Oxygen consumption measurements using instruments like the Seahorse XF Analyzer or Clark-type electrodes can quantify mitochondrial respiratory capacity.

  • Mitochondrial membrane potential assessment: Fluorescent dyes like JC-1 or TMRM can evaluate mitochondrial functionality after AIM36 modification.

  • Metabolomics: Untargeted and targeted metabolomics approaches can identify metabolic bottlenecks or altered pathway utilization resulting from AIM36 modifications.

  • Proteomics: Quantitative proteomics of mitochondrial fractions can reveal compensatory changes in the mitochondrial proteome in response to AIM36 alterations.

These analytical approaches provide a comprehensive assessment of how AIM36 affects mitochondrial metabolism, informing rational engineering strategies for biotechnological applications.

How can CRISPR-Cas9 approaches be optimized for studying AIM36 in A. gossypii?

Optimizing CRISPR-Cas9 for AIM36 modification in A. gossypii requires specialized approaches due to its unique multinucleated syncytial nature:

  • Guide RNA design: Target sequences unique to AIM36 with minimal off-target effects, accounting for A. gossypii's specific genomic context.

  • Delivery method: Transform A. gossypii spores with CRISPR components using electroporation or Agrobacterium-mediated transformation for higher efficiency.

  • Homology-directed repair templates: Design with extended homology arms (>500 bp) to enhance integration efficiency.

  • Selection strategy: Implement a multi-round selection process to ensure homokaryotic transformants where all nuclei contain the desired modification.

  • Verification methods: Use a combination of PCR, sequencing, and functional assays to confirm successful editing of all nuclei.

  • Marker recycling: Employ Cre-loxP systems to remove selection markers, allowing subsequent modifications .

These technical considerations address the challenges posed by A. gossypii's unique cellular structure while leveraging the precision of CRISPR-Cas9 technology.

What approaches can resolve contradictory data on AIM36 function from different experimental systems?

Resolving contradictory findings on AIM36 function requires systematic troubleshooting and validation:

  • Strain validation: Confirm genetic background through whole-genome sequencing to identify potential suppressor mutations or strain-specific variations.

  • Expression level verification: Quantify AIM36 expression levels across experimental systems, as functional outcomes may be concentration-dependent.

  • Post-translational modification analysis: Assess differences in protein modifications between expression systems using mass spectrometry, as these may affect function.

  • Environmental condition standardization: Control for differences in growth conditions, media composition, and cellular state that might influence AIM36 function.

  • Cross-validation with orthogonal methods: Apply multiple independent techniques to measure the same parameter, reducing technique-specific artifacts.

  • In vitro reconstitution: Build complexity stepwise using purified components to identify context-dependent functions.

  • Computational modeling: Develop mathematical models that can integrate disparate data and suggest experiments to resolve contradictions.

This systematic approach helps distinguish genuine biological complexity from experimental artifacts, leading to a more complete understanding of AIM36 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.