Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 39, mitochondrial (AIM39)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If a specific tag is required, please inform us for preferential development.
Synonyms
AIM39; AGL215W; Altered inheritance of mitochondria protein 39, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
87-333
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
AIM39
Target Protein Sequence
QRARKRRGILLALVVAVFGTVFGYSIGYRVFYKHSESFLPLWPAKRSRPLSEKDAANLRV AEVKRMAEFRVFERLSMHKMIKEQFGVPLHTQDGKKPETNVFVLWCEDQDPCITGLLFRP SGSHAPDHGHTWHDFLGLVQWRVTHRPVSIRNAAERVLNFIGLGTSDLFQMVDPSKVYGD FKYEFPLPKRNDNDHAMHICFLGEMPLGPDSLVVYRGKYHVGVRLDQVDLFRREDGKLIR YVLYKNS
Uniprot No.

Target Background

Database Links
Protein Families
AIM39 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Ashbya gossypii AIM39 and what is its significance in mitochondrial research?

Ashbya gossypii AIM39 (UniProt ID: Q751C1) is a mitochondrial protein that plays a crucial role in mitochondrial inheritance patterns. The protein is encoded by the AIM39 gene (also designated as AGL215W) in the filamentous fungus Ashbya gossypii, a model organism particularly valuable for studying organelle inheritance in multinucleated cells . The significance of AIM39 lies in its involvement in the spatial distribution and inheritance of mitochondria during cellular division, which is essential for maintaining cellular energy homeostasis across generations. Understanding AIM39 function contributes to broader knowledge of mitochondrial dynamics, which has implications for fungal biology and potentially for mitochondrial diseases in higher eukaryotes. Researchers interested in fundamental mechanisms of organelle inheritance often utilize AIM39 as a model protein to investigate conserved pathways of mitochondrial distribution.

What are the optimal experimental designs for studying AIM39 function in mitochondrial inheritance?

To effectively study AIM39 function in mitochondrial inheritance, consider the following experimental designs:

Design TypeApplicationAdvantagesLimitations
Cluster Randomized TrialTesting multiple intervention strategies on AIM39 functionReduces contamination between experimental groupsRequires larger sample sizes for statistical power
Interrupted Time SeriesMeasuring effects of AIM39 manipulation over timeCaptures temporal dynamics of mitochondrial inheritanceSusceptible to confounding by concurrent events
Factorial DesignTesting combinations of factors affecting AIM39 activityEfficiently tests multiple variables simultaneouslyComplex interactions may be difficult to interpret
Pre-Post with ControlsBasic interventional studies on AIM39Straightforward implementationLimited ability to control for confounding variables

When designing experiments to investigate AIM39 function, it is critical to incorporate appropriate controls and consider the multilevel nature of mitochondrial inheritance mechanisms . For instance, a study examining AIM39's role in nuclear-mitochondrial coordination might employ a stepped wedge cluster design to introduce genetic modifications sequentially across experimental groups. This approach enables researchers to control for temporal effects while studying how AIM39 manipulation affects mitochondrial distribution patterns in multinucleated hyphae of Ashbya gossypii. Quantitative measurements should include mitochondrial distribution metrics, protein-protein interaction assays, and functional readouts of mitochondrial activity.

What are the recommended methods for expressing and purifying recombinant AIM39 for functional studies?

For optimal expression and purification of recombinant AIM39, the following methodology is recommended:

The most effective expression system for AIM39 is E. coli, particularly when producing the mature protein (amino acids 87-333) with an N-terminal His-tag . Expression should be conducted at reduced temperatures (16-20°C) to enhance proper folding and solubility. The purification protocol typically involves:

  • Cell lysis in Tris-based buffer containing mild detergents to solubilize membrane-associated fractions

  • Initial purification using Ni-NTA affinity chromatography with imidazole gradient elution

  • Secondary purification via size exclusion chromatography

  • Final concentration and buffer exchange to Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

For storage, addition of 50% glycerol and aliquoting prevents degradation during freeze-thaw cycles, with optimal long-term storage at -80°C . When reconstituting lyophilized protein, researchers should use deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL, followed by the addition of glycerol (final concentration 5-50%) for stability . This methodology consistently yields recombinant AIM39 with greater than 90% purity as determined by SDS-PAGE, suitable for downstream functional assays including interaction studies and enzymatic characterizations.

How can researchers effectively study the relationship between AIM39 and nuclear dynamics in Ashbya gossypii?

Studying the relationship between AIM39 and nuclear dynamics in Ashbya gossypii requires sophisticated approaches that integrate multiple cellular systems. Ashbya gossypii offers an excellent model for this research due to its multinucleated hyphae that display extensive bidirectional movements and bypassing of nuclei, coupled with an autonomous cytoplasmic microtubule (cMT) cytoskeleton emanating from each nucleus .

A comprehensive experimental approach should include:

  • Fluorescent tagging of both AIM39 and nuclear markers (such as histone H4-GFP) to enable simultaneous visualization through live-cell imaging

  • Generation of AIM39 deletion mutants (aim39Δ) to assess phenotypic consequences on nuclear positioning and movement

  • Comparative analysis with other gene deletions affecting nuclear dynamics (such as dyn1Δ, kar9Δ, or bim1Δ) to establish pathway relationships

  • Time-lapse microscopy to quantify nuclear movement parameters in wild-type versus mutant strains

Research has shown that in Ashbya gossypii, nuclear dynamics are influenced by cytoplasmic microtubules and their interaction with dynein and cortical proteins . When investigating potential interactions between AIM39 and nuclear positioning machinery, researchers should specifically analyze whether AIM39 deletion affects nuclear clustering, a phenotype that has been observed with mutations in other mitochondrial inheritance proteins. The methodological approach should include interrupted time series measurements of nuclear distribution patterns following genetic or chemical perturbations of AIM39, with statistical analysis of nuclear spacing and movement rates.

What methodological approaches should be used to investigate potential interactions between AIM39 and other mitochondrial proteins?

To investigate interactions between AIM39 and other mitochondrial proteins, researchers should employ a multi-tiered methodological approach:

  • In silico prediction of interaction partners:

    • Conduct sequence-based analyses to identify conserved protein-protein interaction motifs in AIM39

    • Employ protein structure prediction algorithms to model potential binding interfaces

  • Co-immunoprecipitation (Co-IP) studies:

    • Express tagged versions of AIM39 in Ashbya gossypii or heterologous systems

    • Perform pull-down assays followed by mass spectrometry to identify interacting partners

    • Validate key interactions with reverse Co-IP experiments

  • Proximity labeling techniques:

    • Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to AIM39 within mitochondria

    • Analyze the labeled proteome using quantitative mass spectrometry

  • Fluorescence-based interaction assays:

    • Implement Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) to visualize protein interactions in situ

    • Quantify interaction dynamics using live-cell imaging

When designing these experiments, it is crucial to include appropriate controls, such as non-interacting mitochondrial proteins and cytosolic proteins to establish specificity. Additionally, researchers should consider the temporal and spatial dynamics of these interactions, as mitochondrial protein complexes often assemble in response to specific cellular conditions or developmental stages in filamentous fungi.

What are common challenges in AIM39 functional assays and how can they be addressed?

Researchers working with AIM39 functional assays frequently encounter technical challenges that can impede experimental progress. The following table outlines common issues and effective solutions:

ChallengeUnderlying CauseOptimization Strategy
Low protein solubilityHydrophobic regions in mature AIM39Use specialized solubilization buffers containing mild detergents (0.1% DDM or 0.5% CHAPS); express as fusion with solubility-enhancing tags
Limited antibody specificityHigh conservation with homologous proteinsGenerate antibodies against unique epitopes in AIM39; validate specificity using knockout controls; consider epitope-tagged versions
Inconsistent mitochondrial phenotypesVariability in expression levelsImplement inducible expression systems; standardize protein levels using quantitative Western blotting; increase biological replicates
Poor reproducibility in interaction studiesTransient or weak interactionsApply chemical crosslinking before lysis; utilize proximity labeling approaches; optimize buffer conditions to stabilize interactions
Difficulty distinguishing direct from indirect effectsComplex mitochondrial networksEmploy acute perturbation techniques (e.g., auxin-inducible degron systems); perform time-course experiments to establish causality

When troubleshooting functional assays, researchers should systematically modify one variable at a time while maintaining appropriate controls. For mitochondrial localization studies specifically, optimization of fixation protocols is critical to preserve authentic subcellular distribution patterns. The fixation duration and temperature should be carefully calibrated, as over-fixation can create artifacts in mitochondrial morphology that may be incorrectly attributed to AIM39 function .

How should researchers design control experiments when studying AIM39 in the context of nuclear-mitochondrial coordination?

  • Genetic controls:

    • Compare AIM39 deletion (aim39Δ) with wild-type strains under identical conditions

    • Include deletion strains of known nuclear dynamics regulators (e.g., kar9Δ, bim1Δ) as positive controls

    • Create point mutants that selectively disrupt specific domains to distinguish between different protein functions

  • Physiological controls:

    • Assess effects under different growth conditions to identify context-dependent phenotypes

    • Include measurements at multiple time points to distinguish between direct and adaptive effects

    • Compare hyphae at different developmental stages to evaluate stage-specific functions

  • Technical controls:

    • Include multiple independent transformants to control for integration position effects

    • Implement rescue experiments by reintroducing wild-type AIM39 to confirm phenotype specificity

    • Use multiple methodologies to confirm key findings (e.g., combine live imaging with biochemical approaches)

  • Validation controls:

    • Test the effects of benomyl (33 μM) or nocodazole (15 μg/ml) to disrupt microtubule dynamics as a positive control for nuclear movement defects

    • Compare effects on different cell compartments (cytosol, ER, vacuoles) to establish specificity for mitochondria and nuclei

    • Include related fungal species to assess conservation of phenotypes

Control experiments should be designed with statistical power calculations in mind, particularly for quantitative phenotypic analyses. For nuclear distribution studies, a minimum of 50-100 hyphal segments should be analyzed under each condition to achieve reliable statistical significance. These controls collectively enable researchers to distinguish between specific effects of AIM39 perturbation and non-specific consequences of experimental manipulation.

What are the most promising experimental designs for studying evolutionary conservation of AIM39 function across fungal species?

To effectively investigate evolutionary conservation of AIM39 function across fungal species, researchers should consider the following experimental approaches:

Comparative genomics and phylogenetic analysis form the foundation for evolutionary studies of AIM39. This should be followed by functional complementation assays, where AIM39 homologs from different fungal species are expressed in an Ashbya gossypii aim39Δ background to assess functional conservation. Domain-swapping experiments, where specific regions from different species' AIM39 proteins are exchanged, can identify functionally conserved domains.

The most statistically robust experimental design for cross-species functional analysis is a factorial design that simultaneously tests multiple species variants under different environmental conditions . This approach allows researchers to distinguish between species-specific adaptations and core conserved functions. For quantitative comparisons, researchers should implement interrupted time series designs that measure mitochondrial distribution patterns before and after perturbation of AIM39 across different species .

When analyzing data from cross-species experiments, hierarchical statistical models are recommended to account for both within-species and between-species variations. Visualization techniques such as heatmaps of functional conservation can effectively communicate complex patterns across evolutionary distances.

How can advanced imaging methodologies be optimized for studying AIM39 localization and dynamics?

Advanced imaging methodologies for studying AIM39 localization and dynamics require careful optimization to generate reliable and informative data:

  • Super-resolution microscopy approaches:

    • Structured Illumination Microscopy (SIM) provides ~120 nm resolution, suitable for resolving mitochondrial subcompartments

    • Stochastic Optical Reconstruction Microscopy (STORM) or Photoactivated Localization Microscopy (PALM) offer higher resolution (~20-30 nm) but require specialized fluorophores

    • Stimulated Emission Depletion (STED) microscopy provides excellent resolution for studying AIM39 distribution within mitochondrial membranes

  • Live-cell imaging optimization:

    • For Ashbya gossypii, maintain cultures in Ashbya Full Medium (AFM: 1% Bacto peptone, 1% yeast extract, 2% glucose, and 0.1% myo-inositol) at 30°C during imaging

    • Use low-intensity illumination with high-sensitivity cameras to minimize phototoxicity

    • Implement temperature-controlled microscope stages to maintain optimal growth conditions

  • Multi-color imaging strategies:

    • Combine AIM39 labeling with mitochondrial markers (MitoTracker) and nuclear labels (H4-GFP)

    • Use spectrally distinct fluorophores with minimal bleed-through

    • Implement sequential acquisition protocols to minimize cross-talk between channels

  • Quantitative image analysis:

    • Develop automated segmentation algorithms to identify and track individual mitochondria

    • Implement trajectory analysis for measuring organelle movements

    • Use colocalization analysis with statistical validation to quantify spatial relationships

To specifically optimize imaging for Ashbya gossypii, researchers should use z-stack acquisition with 0.2-0.5 μm steps to capture the three-dimensional hyphal structure. Time-lapse parameters should be adjusted to capture both rapid events (e.g., 5-second intervals for mitochondrial movement) and long-term processes (e.g., 5-minute intervals for inheritance patterns over several hours). For quantitative analysis of nuclear-mitochondrial coordination, dual-color time-lapse imaging with nuclear (H4-GFP) and mitochondrial markers enables measurement of organelle velocities, directional persistence, and interaction frequencies.

What methodological approaches show the most promise for integrating AIM39 studies with broader mitochondrial dynamics research?

Integrating AIM39 studies with broader mitochondrial dynamics research requires methodological approaches that bridge multiple scales of biological organization:

Systems biology frameworks offer the most promising avenue for integration, combining proteomics, transcriptomics, and metabolomics to create comprehensive models of mitochondrial network function. Multi-omics data integration should be performed using computational algorithms that account for the hierarchical organization of biological systems.

For experimental designs, within- and between-site approaches such as stepped wedge cluster randomized controlled trials allow for systematic testing of interventions across different experimental conditions . These designs are particularly valuable when studying how AIM39 perturbations affect various aspects of mitochondrial function, including respiration, membrane potential, and mitophagy.

Cutting-edge methodologies that show particular promise include:

  • CRISPR-based genetic screens to identify functional interactions between AIM39 and other mitochondrial proteins

  • Optical control of protein activity (optogenetics) to achieve precise temporal manipulation of AIM39 function

  • Multi-scale imaging approaches that integrate molecular-level and cellular-level observations

  • Mathematical modeling to predict emergent properties of mitochondrial networks in the presence and absence of functional AIM39

These integrated approaches will enable researchers to move beyond correlative observations and establish causal relationships between AIM39 function and broader mitochondrial dynamics, ultimately contributing to a systems-level understanding of organelle inheritance mechanisms.

How should researchers design experiments to address contradictory findings about AIM39 function?

When addressing contradictory findings about AIM39 function, researchers should implement rigorous experimental designs that explicitly test competing hypotheses:

  • Direct replication studies:

    • Precisely reproduce original experimental conditions, including strain backgrounds, media compositions, and environmental parameters

    • Increase statistical power by using larger sample sizes than the original studies

    • Pre-register experimental protocols and analysis plans to minimize confirmation bias

  • Factorial designs to identify context-dependent effects:

    • Systematically vary parameters that differ between contradictory studies (e.g., temperature, carbon source, growth phase)

    • Implement a 2×2 factorial randomized design to test for interaction effects between experimental variables

    • Analyze results using appropriate statistical methods that can detect interaction effects

  • Multi-laboratory validation:

    • Establish collaborative networks to perform identical experiments in different laboratory settings

    • Standardize protocols, reagents, and analytical methods across sites

    • Implement blinded analysis of results to minimize experimenter bias

  • Integration of multiple methodological approaches:

    • Combine genetic, biochemical, and imaging approaches to triangulate findings

    • Use both loss-of-function and gain-of-function experiments to establish causality

    • Develop quantitative mathematical models to test whether contradictory observations can be reconciled within a unified framework

When designing specific experiments to address contradictions, researchers should develop an explicit "decision tree" that outlines how different outcomes would support or refute competing hypotheses. For example, if contradictory findings exist regarding AIM39's role in mitochondrial inheritance, researchers might design a stepped wedge trial that sequentially introduces different perturbations (genetic deletion, point mutations, overexpression) and measures multiple outcome variables (mitochondrial distribution, movement dynamics, interaction partners) . This comprehensive approach increases the likelihood of identifying the specific conditions under which seemingly contradictory results can be reconciled into a coherent understanding of AIM39 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.