Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
INA17; ABR190C; Inner membrane assembly complex subunit 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-159
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
INA17
Target Protein Sequence
SPQTLEELARLKSLEDVDSSVIRKLINQRTEEVNAQNEAQMLKKLSAEGRDLQNVPGSRY ARPLWLLLIGCASVYLVRDWLRMKAEYDARETTLETRVEGLEAELKYLLEPKPGVLEVEV VQTEVASSAPWYKRWLWSGSR
Uniprot No.

Target Background

Function

Recombinant Ashbya gossypii Altered Inheritance of Mitochondria protein 43, mitochondrial (AIM43) is a component of the Inner Mitochondrial Membrane Associated Complex (INAC). It plays a crucial role in the biogenesis of mitochondrial F1F0-ATP synthase. Specifically, INAC facilitates the assembly of the peripheral stalk and promotes the integration of the catalytic F1-domain with the membrane-embedded F0-domain.

Database Links
Protein Families
INA17 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it important as a model organism?

Ashbya gossypii is a riboflavin-overproducing filamentous fungus that is closely related to unicellular yeasts such as Saccharomyces cerevisiae. This close evolutionary relationship, combined with its distinct filamentous growth pattern, makes it an excellent model organism for studying the regulatory networks that govern the differences between filamentous and yeast growth forms .

The importance of A. gossypii as a model organism is further enhanced by the completion of its genome sequence, which facilitates genetic manipulation and comparative genomic studies . Additionally, A. gossypii has significant biotechnological importance due to its natural ability to overproduce riboflavin (vitamin B2), making it valuable for industrial applications .

Understanding the growth regulation in A. gossypii could also provide insights into related dimorphic yeasts like the human fungal pathogen Candida albicans, where the morphological switch between yeast and filamentous forms is critical for virulence .

How does A. gossypii differ from S. cerevisiae in terms of mitochondrial inheritance?

Ashbya gossypii, as a filamentous fungus, has distinct mitochondrial inheritance patterns compared to unicellular yeasts like Saccharomyces cerevisiae. While the search results don't directly address this specific comparison, we can infer some key differences based on the biological context.

A. gossypii is multinucleate, meaning its cells contain multiple nuclei within a continuous cytoplasm, whereas S. cerevisiae is uninucleate with discrete cells . This fundamental difference necessitates specialized mechanisms for mitochondrial distribution and inheritance in A. gossypii. Unlike S. cerevisiae, which partitions mitochondria between mother and daughter cells during budding, A. gossypii must ensure proper distribution of mitochondria throughout its growing hyphal network.

The presence of specific proteins like AIM43 in A. gossypii suggests evolved mechanisms to manage mitochondrial inheritance in its filamentous growth form. Mitochondrial distribution in filamentous fungi typically requires coordination with the cytoskeleton for long-distance transport along hyphae, representing a more complex spatial organization challenge than in unicellular yeasts.

What are the optimal conditions for expressing recombinant AIM43 protein from A. gossypii?

Based on the product information available for recombinant A. gossypii AIM43, the following conditions are important for proper expression and handling:

Storage and Stability:

  • Store the recombinant protein at -20°C

  • For extended storage, conserve at -20°C or -80°C

  • Repeated freezing and thawing is not recommended

  • Working aliquots can be stored at 4°C for up to one week

Buffer Conditions:

  • The protein is typically stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein

While the search results don't provide the complete expression protocol, researchers working with A. gossypii often use integrative expression cassettes rather than episomic vectors, as the latter are not fully stable in this organism . For heterologous expression, the strong GPD1 promoter (P GPD1) has been successfully used in A. gossypii for reporter proteins .

When designing expression systems for A. gossypii proteins, it's important to consider that genomic integrative cassettes typically include:

  • Recombinogenic flanks for targeted integration

  • Selection markers (such as loxP-KanMX-loxP for G418 resistance)

  • Strong promoters (like P GPD1)

  • The target gene (in this case, AIM43)

  • Appropriate terminator sequences (such as PGK1 terminator)

What methods are most effective for studying the localization and function of AIM43 in A. gossypii?

Several methodological approaches can be employed to study AIM43 localization and function in A. gossypii:

Fluorescent Protein Tagging:
Similar to approaches used for other A. gossypii proteins, GFP fusion proteins can be created to visualize the subcellular localization of AIM43. For example, in studies of other A. gossypii proteins, researchers have successfully used GFP-fusion proteins to demonstrate nuclear localization .

Luciferase Reporter Assays:
Dual luciferase reporter assays have been effectively used in A. gossypii to measure promoter activities and gene expression levels. This system employs Renilla luciferase as an internal control and firefly luciferase as the experimental reporter . This approach could be adapted to study AIM43 expression patterns under different conditions.

Gene Disruption and Phenotypic Analysis:
Creating AIM43 knockout strains (ΔAIM43) would allow for phenotypic characterization. The Golden Gate modular cloning system has been adapted for A. gossypii and can be used for targeted gene disruption . After disruption, researchers should analyze:

  • Growth patterns

  • Mitochondrial distribution (using mitochondrial stains)

  • Cell cycle progression

  • Response to different environmental stresses

Real-time Quantitative PCR:
RT-qPCR can be used to measure expression levels of AIM43 under different conditions, similar to approaches used for other A. gossypii genes . This method can reveal regulatory relationships and expression patterns throughout different growth phases.

What genetic manipulation techniques are most successful in A. gossypii?

A. gossypii is amenable to genetic manipulation through several established techniques:

Integrative Transformation:
Episomic vectors are not fully stable in A. gossypii, so genomic integrative cassettes are preferred for stable expression . The integration process typically involves:

  • Construction of integrative cassettes containing:

    • Recombinogenic flanks targeting specific loci

    • Selection markers (often loxP-KanMX-loxP for G418 resistance)

    • Promoter, gene of interest, and terminator sequences

  • Transformation into A. gossypii cells

  • Selection on appropriate media containing antibiotics (such as G418)

  • Verification of integration by analytical PCR

Marker Elimination System:
After successful integration, marker elimination can be achieved using Cre recombinase expression systems. This allows for sequential genetic modifications using the same selection marker .

Golden Gate Modular Cloning:
A. gossypii-specific Golden Gate modular cloning systems have been developed, facilitating the assembly of complex genetic constructs .

Insertional Mutagenesis:
Transposon-based insertional mutagenesis methods have been developed specifically for A. gossypii. For example, Himar1-derived transposons with G418 resistance markers and oriC replication origins allow for recovery and identification of genomic integration sites .

How can researchers differentiate between direct and indirect effects when studying AIM43 function?

Differentiating between direct and indirect effects when studying AIM43 function presents several challenges. Researchers should employ the following methodological approaches:

Controlled Expression Systems:
Implement inducible or repressible promoter systems to achieve temporal control over AIM43 expression. This helps distinguish immediate (likely direct) effects from delayed (potentially indirect) effects following AIM43 manipulation.

Domain Mutation Analysis:
Create targeted mutations in specific domains of AIM43 rather than complete gene deletions. The expression region from amino acids 19-159 would be particularly interesting for mutation studies . This approach can help identify which protein interactions or functions are directly mediated by specific regions of AIM43.

Omics Integration:
Combine multiple omics approaches to build a comprehensive picture:

  • Transcriptomics to identify genes whose expression changes upon AIM43 manipulation

  • Proteomics to identify protein-protein interaction partners

  • Metabolomics to detect metabolic changes

Phosphorylation Analysis:
As demonstrated with other proteins in A. gossypii, phosphoregulation can provide specificity to protein function. For example, in the case of Whi3, differential phosphorylation of specific residues created functional specificity for either cell polarity or nuclear cycling . Similar approaches could reveal whether AIM43 is subject to post-translational modifications that influence its function.

Comparative Analysis with Related Organisms:
Compare AIM43 function between A. gossypii and related organisms like S. cerevisiae. This can help identify conserved versus species-specific functions, particularly in the context of the different growth forms (filamentous vs. unicellular).

What approaches can address data reproducibility challenges when working with A. gossypii and AIM43?

Ensuring reproducibility when working with A. gossypii and studying AIM43 requires addressing several challenges specific to this experimental system:

Standardization of Growth Conditions:
A. gossypii exhibits distinct trophic and productive phases with different physiological characteristics . Researchers should:

  • Precisely document and standardize growth media composition

  • Control temperature, pH, and aeration conditions

  • Standardize inoculum preparation and age

  • Establish clear time points for sampling relative to growth phases

Dual Reporter Systems:
Implement dual reporter systems similar to the Renilla/firefly luciferase approach that has been successfully used in A. gossypii . This improves experimental accuracy by providing an internal control.

Strain Validation:

  • Verify integration of expression cassettes by analytical PCR

  • Confirm protein expression by Western blotting

  • Validate strain phenotypes across multiple independent transformants

Quantification Standards:
When measuring parameters like mitochondrial distribution or protein localization, establish:

  • Consistent imaging parameters

  • Standardized quantification methods

  • Appropriate statistical analyses

Detailed Methods Reporting:
Document comprehensive methods including:

  • Strain construction details

  • Primer sequences

  • PCR conditions

  • Buffer compositions

  • Image acquisition parameters

A table outlining standardized growth conditions for A. gossypii experimentation could be structured as follows:

ParameterTrophic PhaseProductive PhaseNotes
Growth mediumComplex medium (e.g., AFM)Defined minimal mediumMedium transition triggers phase change
Temperature30°C28-30°CTemperature shifts may affect riboflavin production
Agitation200 rpm180 rpmFor liquid cultures
pH6.0-6.56.5-7.0Buffer with appropriate components
Sampling times8-16h post-inoculation48-96h post-inoculationStrain-dependent variations may occur
Cell density measurementOD600 or dry weightBiomass dry weightFilamentous growth complicates optical measurements

How does mitochondrial protein AIM43 interact with other cellular pathways in A. gossypii?

Understanding the interactions between AIM43 and other cellular pathways requires integrative analysis. While the search results don't provide direct information about AIM43's specific interactions, we can infer potential pathways based on knowledge of mitochondrial proteins and A. gossypii biology:

Purine Biosynthesis Pathway:
A. gossypii has well-characterized purine biosynthesis pathways regulated by transcription factors like BAS1 . Mitochondrial function is tightly linked to nucleotide metabolism, suggesting potential interactions between AIM43 and these pathways. Researchers should investigate whether:

  • AIM43 disruption affects purine biosynthesis gene expression

  • BAS1 or other transcription factors regulate AIM43 expression

  • Metabolic changes in purine pathways impact AIM43 function

Riboflavin Production Pathway:
As a riboflavin overproducer, A. gossypii shows connections between mitochondrial function and vitamin production. For example, BAS1 mutants show enhanced riboflavin production . Researchers could investigate:

  • Whether AIM43 mutations affect riboflavin production

  • If there are direct or indirect interactions between AIM43 and riboflavin biosynthetic enzymes

  • How mitochondrial inheritance patterns influence riboflavin production capacity

Cell Cycle and Growth Phase Transitions:
A. gossypii exhibits distinct trophic and productive phases, with different gene expression patterns in each phase . The multinucleate nature of A. gossypii requires coordinated nuclear division and mitochondrial inheritance. Research questions could include:

  • Does AIM43 function differently during different growth phases?

  • How does AIM43 coordinate with nuclear division in this multinucleate organism?

  • Is AIM43 regulated by growth phase-specific factors?

Biomolecular Condensation:
In A. gossypii, RNA-binding proteins like Whi3 regulate the cell cycle and cell polarity through forming macromolecular structures that behave like condensates . Researchers could explore:

  • Whether AIM43 participates in biomolecular condensates

  • If phosphoregulation of AIM43 (similar to Whi3) provides functional specificity

  • How mitochondrial proteins might interact with cytoplasmic condensates

What are the implications of AIM43 research for understanding mitochondrial diseases in higher organisms?

Although A. gossypii is a fungal model, insights from AIM43 research could have broader implications for understanding mitochondrial diseases in higher organisms:

Evolutionary Conservation Analysis:
Researchers should investigate the evolutionary conservation of AIM43 across species:

  • Identify homologs in model organisms (yeast, worms, flies, mice) and humans

  • Compare protein sequences, domains, and functions

  • Determine whether homologs are associated with mitochondrial diseases

Mitochondrial Genome Maintenance:
Recent research has highlighted the importance of mitochondrial DNA (mtDNA) constraint models in human health and disease . If AIM43 plays a role in mitochondrial genome stability in A. gossypii, this could provide insights into similar processes in humans.

Human mitochondrial DNA shows strong depletion of expected variation, suggesting many deleterious mtDNA variants remain undetected . Comparative studies between A. gossypii AIM43 and human mitochondrial proteins could help understand:

  • How mitochondrial inheritance is regulated across species

  • Whether similar constraint mechanisms operate in fungi and humans

  • If homologous proteins are involved in mitochondrial genome protection

Translational Research Approaches:
To establish clinical relevance, researchers could:

  • Express human mitochondrial disease-associated proteins in A. gossypii

  • Determine if they complement AIM43 mutations

  • Use A. gossypii as a screening platform for compounds that rescue mitochondrial inheritance defects

How can systems biology approaches enhance our understanding of AIM43 function in the context of A. gossypii's filamentous lifestyle?

Systems biology offers powerful tools to understand AIM43 function in the context of A. gossypii's unique biology:

Multi-omics Integration:
Combine multiple data types to build comprehensive models:

  • Genomics: Comparative analysis across related species

  • Transcriptomics: Expression patterns across growth conditions

  • Proteomics: Interaction networks and post-translational modifications

  • Metabolomics: Metabolic changes associated with AIM43 function

Spatial Organization Modeling:
A. gossypii's filamentous, multinucleate structure requires sophisticated spatial organization. Researchers could:

  • Develop mathematical models of mitochondrial distribution throughout hyphae

  • Simulate the effects of altered AIM43 function on mitochondrial inheritance

  • Create visualization tools to track mitochondrial movement in growing mycelia

Regulatory Network Analysis:
Construct gene regulatory networks to understand how AIM43 integrates with other systems:

  • Identify transcription factors regulating AIM43 expression

  • Map AIM43-dependent changes in gene expression

  • Model how AIM43 function changes across growth phases

Comparative Systems Approach:
Compare A. gossypii with both filamentous fungi and unicellular yeasts:

  • Identify unique and conserved aspects of mitochondrial inheritance

  • Determine how mitochondrial proteins are adapted to different growth forms

  • Explore how filamentous growth constraints shape mitochondrial dynamics

What emerging technologies could advance the study of AIM43 and mitochondrial inheritance in A. gossypii?

Several cutting-edge technologies show promise for advancing our understanding of AIM43:

CRISPR-Cas9 Genome Editing:
While not mentioned in the search results as being applied to A. gossypii specifically, CRISPR-Cas9 technology could:

  • Enable precise editing of AIM43 to create specific mutations

  • Facilitate creation of AIM43 variants with tagged domains

  • Allow simultaneous editing of multiple genes to study interaction networks

Live-Cell Super-Resolution Microscopy:
Advanced imaging techniques could:

  • Visualize AIM43 localization within mitochondrial subcompartments

  • Track individual mitochondria during hyphal growth

  • Monitor the dynamics of mitochondrial inheritance in real-time

Single-Cell/Single-Nucleus Sequencing:
A. gossypii's multinucleate nature makes it an interesting candidate for:

  • Analysis of transcriptional heterogeneity among nuclei within a single mycelium

  • Investigation of how mitochondria influence nuclear gene expression

  • Exploration of nuclear-mitochondrial communication in shared cytoplasm

Synthetic Biology Approaches:
Engineering A. gossypii with synthetic genetic circuits could:

  • Create inducible AIM43 expression systems

  • Design reporter systems that respond to mitochondrial state

  • Develop controllable mitochondrial inheritance patterns

How might climate change and environmental stressors affect mitochondrial functions mediated by proteins like AIM43?

Environmental stressors increasingly relevant in climate change scenarios could impact mitochondrial function:

Temperature Adaptation:
Recent research has shown that intrinsically disordered sequences can tune fungal growth and cell cycle for specific temperatures, as indicated in the citations to article . Researchers should investigate:

  • Whether AIM43 contains intrinsically disordered regions

  • How temperature affects AIM43 function and mitochondrial distribution

  • If AIM43 plays a role in temperature adaptation

Oxidative Stress Response:
Climate change may increase oxidative stress through multiple mechanisms. Studies should examine:

  • Whether AIM43 is phosphorylated in response to H₂O₂, as has been observed for other proteins in filamentous fungi (cited in reference to article )

  • If AIM43 helps protect mitochondria from oxidative damage

  • Whether AIM43 participates in stress response signaling

Metabolic Adaptation:
Changing environments may require metabolic flexibility. Research could explore:

  • How AIM43 and mitochondrial function respond to nutrient limitation

  • Whether AIM43 plays a role in adapting to carbon source changes

  • If mitochondrial inheritance patterns shift under resource constraints

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.