Recombinant Ashbya gossypii Autophagy-related protein 32 (ATG32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ATG32; AFR283W; Autophagy-related protein 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
ATG32
Target Protein Sequence
MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNL CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML
Uniprot No.

Target Background

Function
Recombinant Ashbya gossypii Autophagy-related protein 32 (ATG32) is a mitophagy-specific receptor that recruits the autophagic machinery to mitochondria. It regulates the selective degradation of mitochondria, contributing to mitochondrial quality control by maintaining optimal mitochondrial quantity and preventing excessive ROS production. ATG32 achieves this by recruiting ATG11 to the mitochondrial surface, and also promotes autophagy-dependent peroxisome degradation.
Database Links
Protein Families
ATG32 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Vacuole membrane; Single-pass membrane protein. Preautophagosomal structure membrane; Single-pass membrane protein.

Q&A

What is Autophagy-related Protein 32 (ATG32) and what is its primary function?

ATG32 is a transmembrane protein that plays an essential role in mitochondrial autophagy (mitophagy) in yeasts. It functions as a receptor protein that confers selectivity during mitophagic processes, acting as a direct initiator at the early stages of mitochondria autophagy . ATG32 is inserted into the outer membrane of mitochondria with its N-terminal domain exposed to the cytosol and its C-terminal domain extending into the mitochondrial intermembrane space (IMS) . The protein serves as a critical molecular platform that recruits core autophagy machinery components to the mitochondrial surface, thereby facilitating the targeted degradation of mitochondria through the autophagy pathway .

How is ATG32 structurally organized in Ashbya gossypii?

ATG32 in Ashbya gossypii consists of three main structural domains:

  • The cytosol domain (N-terminal region): This contains the Atg8 family-interacting motif (AIM) and regions that interact with Atg11

  • The transmembrane (TM) domain: Anchors the protein to the mitochondrial outer membrane

  • The intermembrane space (IMS) domain (C-terminal region): Extends into the mitochondrial intermembrane space

Research has demonstrated that while the cytosol domain is essential for ATG32 function and must be anchored to the mitochondrial surface, the IMS domain is dispensable for mitophagy . The TM domain can be functionally replaced by other membrane anchors, suggesting it primarily serves a localization rather than a specific functional role .

How does ATG32 expression change under different cellular conditions?

ATG32 expression is highly regulated by cellular metabolic conditions. The protein levels increase significantly (10-20 fold) when cells are grown in media containing non-fermentable carbon sources such as glycerol or lactate, which require mitochondrial ATP production through respiration . In contrast, when cells are grown in glucose-containing media, which supports glycolytic ATP production without substantial mitochondrial involvement, ATG32 expression remains relatively low . This differential expression pattern aligns with the protein's role in mitophagy, as respiratory growth conditions often necessitate increased mitochondrial quality control.

What are the recommended approaches for recombinant expression of Ashbya gossypii ATG32?

For recombinant expression of Ashbya gossypii ATG32, researchers typically employ:

  • Baculovirus expression systems: These systems are particularly effective for expressing membrane proteins like ATG32

  • Yeast expression systems: Using S. cerevisiae under the control of inducible promoters (such as GAL promoters) for expression of full-length or domain-specific constructs

When expressing recombinant ATG32, consider the following methodological approaches:

  • For structural studies: Express the cytosol domain (residues 1-388) as it contains the key functional regions while avoiding the hydrophobic transmembrane domain that can complicate protein purification

  • For localization studies: Create fusion proteins with fluorescent tags (GFP, RFP) at the N-terminus to prevent interference with membrane insertion

  • For functional studies: Express under native or regulatable promoters to control expression levels in accordance with experimental needs

Importantly, when working with recombinant ATG32 preparations, storage conditions should be optimized, and the protein can typically be shipped without dry ice according to standard protocols .

What experimental methods are most effective for studying ATG32 interactions with other autophagy proteins?

The following experimental approaches have proven effective for studying ATG32 interactions:

  • Yeast two-hybrid assays: Effective for detecting binary protein interactions, such as those between ATG32 and ATG11 . This approach has successfully demonstrated direct interactions between ATG32 and core autophagy machinery components.

  • Co-immunoprecipitation assays: Allow detection of protein-protein interactions under more native conditions. For example:

    Bait ProteinPrey ProteinInteraction StrengthCondition
    ATG32-HAATG8-PEStrongRespiratory growth
    ATG32 AQAA-HAATG8-PEReducedRespiratory growth
    ATG32-HAATG11StrongRespiratory growth
  • X-ray crystallography: Has been used to determine the structure of ATG32 peptides (particularly the ATG8 family-interacting motif) in complex with ATG8, revealing binding interfaces important for mitophagy .

  • Fluorescence microscopy with dual-labeled proteins: Enables visualization of ATG32 co-localization with mitochondrial markers and other autophagy proteins during mitophagy .

What controls should be included when performing ATG32-dependent mitophagy assays?

When designing mitophagy assays to evaluate ATG32 function, include the following controls:

  • Positive controls:

    • Wild-type cells expressing full-length ATG32 under respiratory growth conditions

    • Mitochondrial matrix reporter (e.g., mito-DHFR-mCherry) to track mitochondrial degradation

  • Negative controls:

    • atg1Δ strain (defective in all autophagy-related processes)

    • atg11Δ strain (defective in selective autophagy pathways)

    • atg32Δ strain (specifically defective in mitophagy)

  • Specificity controls:

    • Monitor non-selective autophagy using appropriate markers to confirm that general autophagy remains unaffected

    • Assess other selective autophagy pathways (e.g., Cvt pathway using prApe1 processing, pexophagy using Pex14-GFP) to confirm specificity

  • Domain functionality controls:

    • ATG32 variants lacking specific domains (e.g., ATG32(1-388) lacking TM and IMS domains)

    • ATG32 with domain substitutions (e.g., ATG32(1-388)-TA mito with an alternative mitochondrial anchor)

How do mutations in the ATG8 interaction region of ATG32 affect mitophagy efficiency?

Mutations in the ATG8 interaction region of ATG32, particularly the ATG8 family-interacting motif (AIM), have significant but not complete effects on mitophagy. Key findings include:

  • The ATG32 AIM peptide (Ser-Trp-Gln-Ala-Ile-Gln, corresponding to residues 85-90) binds directly to ATG8 in a conserved manner, as revealed by X-ray crystallography .

  • ATG32 AQAA mutants (with alanine substitutions in the AIM) show:

    • Reduced binding to ATG8 in yeast two-hybrid assays

    • Decreased but not abolished interaction with ATG8 in co-immunoprecipitation assays

    • Only mild defects in mitophagy (approximately 88% of wild-type levels)

  • Combined mutations in both ATG32 (AQAA) and the AIM-binding interface of ATG8 (P52A/R67A) result in synthetic defects:

    • Mitophagy efficiency drops to approximately 60% of wild-type levels

    • This suggests that the ATG32-ATG8 interaction is important but potentially redundant with other interaction interfaces

These findings indicate that while the AIM-mediated interaction between ATG32 and ATG8 contributes to efficient mitophagy, additional protein-protein interfaces likely exist that provide functional redundancy in the mitophagic process.

Can the cytosolic domain of ATG32 promote autophagy of other organelles when artificially targeted?

Yes, remarkably, the cytosolic domain of ATG32 can promote autophagy of other organelles when artificially targeted to their surfaces. This finding has significant implications for understanding the fundamental mechanisms of selective autophagy.

When the ATG32 cytosolic domain (residues 1-388) was fused to a peroxisomal transmembrane domain (ATG32(1-388)-TM pexo-HA) and expressed under the ATG32 promoter:

  • The chimeric protein was strongly induced during respiratory growth

  • The peroxisomal matrix marker Pot1-GFP accumulated in vacuoles when the chimeric protein was expressed

  • This peroxisome degradation was completely dependent on ATG1, confirming it occurs through authentic autophagy

This experimental result demonstrates that:

  • The ATG32 cytosolic domain contains a "degron-like module" capable of recruiting the core autophagy machinery

  • ATG32 is likely the sole mitochondrial protein necessary and sufficient to directly mediate mitophagy

  • The organelle specificity of selective autophagy can be redirected by targeting autophagy receptor proteins to different cellular compartments

These findings have broad implications for the engineering of selective autophagy systems and understanding the common mechanistic principles underlying different selective autophagy pathways.

What is the temporal sequence of ATG32-mediated protein interactions during mitophagy initiation?

The temporal sequence of ATG32-mediated protein interactions during mitophagy initiation reveals a coordinated recruitment process:

  • Initial state: ATG32 is embedded in the mitochondrial outer membrane with its N-terminal domain exposed to the cytosol and C-terminal domain in the intermembrane space .

  • Early interaction phase:

    • ATG32 interacts with the free form of ATG8 (not yet conjugated to phosphatidylethanolamine/PE) through its AIM motif

    • ATG32 simultaneously recruits ATG11, which functions as a scaffold protein for selective autophagy

    • These interactions form an "initiator complex" on the mitochondrial surface prior to and independent of isolation membrane generation

  • Membrane recruitment phase:

    • The ATG32-ATG8-ATG11 complex facilitates the recruitment of additional autophagy machinery components

    • This leads to the formation of isolation membranes around the targeted mitochondria

  • Completion phase:

    • The isolation membrane expands to form complete autophagosomes containing mitochondrial cargo

    • These autophagosomes are subsequently delivered to vacuoles for degradation

Importantly, research has demonstrated that ATG32 forms complexes with ATG8 and ATG11 prior to and independent of isolation membrane generation, indicating that ATG32 acts at the earliest stages of mitophagy as a direct initiator of the process .

How conserved is the ATG32-mediated mitophagy mechanism across fungal species?

The ATG32-mediated mitophagy mechanism appears to be conserved across fungal species, with evidence suggesting that the core molecular features may extend beyond fungi to higher eukaryotes. Key findings include:

  • The ATG32 protein was initially characterized in Saccharomyces cerevisiae, where it plays an essential role in mitophagy

  • Studies with Ashbya gossypii ATG32 demonstrate functional conservation of the protein's role in mitochondrial quality control in this filamentous fungus

  • The molecular features of ATG32-mediated mitophagy—particularly the interactions with core autophagy machinery components like ATG8 and ATG11—appear to be conserved functional modules

  • Research suggests that this might be a common molecular feature in mitochondria autophagy conserved from yeast to humans, though the specific receptor proteins may differ

While ATG32 itself does not have direct homologs in mammalian cells, the functional principle of transmembrane receptor proteins that recruit autophagy machinery to mitochondria is conserved. In mammals, proteins such as BNIP3, NIX, and FUNDC1 serve analogous roles in mitophagy, suggesting evolutionary conservation of the mechanistic principles first identified in fungal ATG32-mediated mitophagy.

What technical challenges exist in working with full-length recombinant ATG32 versus domain-specific constructs?

Working with full-length recombinant ATG32 presents several technical challenges compared to domain-specific constructs:

  • Membrane protein purification issues:

    • The transmembrane domain of full-length ATG32 creates solubility challenges

    • Requires detergent-based extraction and purification methods

    • May have lower expression yields in recombinant systems

  • Structural analysis limitations:

    • Full-length membrane proteins are more difficult to crystallize for X-ray diffraction studies

    • Domain-specific constructs (e.g., the cytosolic domain or AIM peptide) are more amenable to structural determination

  • Functional reconstitution complexity:

    • Full-length ATG32 requires incorporation into lipid bilayers for functional studies

    • Domain-specific constructs can be studied in solution-based assays

  • Expression system considerations:

    • Full-length ATG32 is typically expressed using baculovirus systems

    • The cytosolic domain can be expressed in E. coli or yeast expression systems with higher yields

Research has shown that for many functional studies, the cytosolic domain (residues 1-388) is sufficient when properly targeted to mitochondria . This finding has facilitated experimental approaches using domain-specific constructs that avoid many of the technical challenges associated with full-length membrane protein work.

What is the potential for developing ATG32-based tools for modulating mitochondrial quality control in research applications?

The unique properties of ATG32 offer significant potential for developing research tools to modulate mitochondrial quality control:

  • Inducible mitophagy systems:

    • ATG32 overexpression under inducible promoters could create on-demand mitophagy systems for studying mitochondrial turnover

    • This approach would leverage the finding that ATG32 protein levels directly correlate with mitophagy induction

  • Organelle-specific degradation tools:

    • The demonstrated ability of the ATG32 cytosolic domain to promote autophagy of different organelles when artificially targeted suggests applications for creating "designer autophagy" systems

    • Such tools could allow researchers to selectively degrade specific organelle populations

  • Mitochondrial quality control research:

    • ATG32-based tools could help elucidate the relationship between mitophagy and neurodegenerative diseases

    • This connection is suggested by evidence linking mitophagy defects to various pathological conditions

  • Structure-function exploration:

    • Chimeric proteins utilizing the ATG32 cytosolic domain fused to different targeting sequences could help identify the minimal requirements for selective autophagy

    • The crystal structure of ATG32-ATG8 interactions provides a foundation for designing modified interaction interfaces with altered properties

Such tools would be particularly valuable for studying fundamental questions about mitochondrial quality control mechanisms and their relationship to cellular homeostasis, aging, and disease states.

How can researchers address variable expression levels of recombinant ATG32 in different systems?

Researchers facing variable expression levels of recombinant ATG32 can implement these methodological approaches:

  • Optimize expression conditions based on growth medium:

    • For strong induction, use non-fermentable carbon sources like glycerol or lactate

    • ATG32 protein levels increase 10-20 fold in glycerol-grown cells compared to glucose-grown cells

  • Select appropriate expression systems:

    • Baculovirus systems are effective for full-length ATG32 expression

    • For domain-specific constructs, E. coli or yeast systems may provide higher yields

  • Use domain-specific constructs:

    • The cytosolic domain (1-388) expresses more consistently than full-length protein

    • This domain retains functional activity when properly targeted to mitochondria

  • Implement codon optimization:

    • Adjust codon usage to match the expression host for improved translation efficiency

    • This is particularly important when expressing Ashbya gossypii proteins in heterologous systems

  • Address protein stability issues:

    • Include protease inhibitors during purification

    • Consider fusion tags that enhance stability (e.g., MBP, SUMO)

    • Store purified protein appropriately to maintain activity

These approaches, when systematically implemented, can help overcome the variable expression challenges commonly encountered with ATG32 and other mitochondrial membrane proteins.

What control experiments are essential to validate the specificity of ATG32-mediated effects in mitophagy assays?

To validate the specificity of ATG32-mediated effects in mitophagy assays, the following control experiments are essential:

  • Genetic complementation controls:

    • Express wild-type ATG32 in atg32Δ cells to confirm rescue of mitophagy

    • Include domain mutants (e.g., AIM mutants) to demonstrate specific functional requirements

  • Pathway specificity controls:

    • Monitor multiple selective autophagy pathways in parallel:

      • Cvt pathway (using prApe1 processing)

      • Pexophagy (using Pex14-GFP processing)

      • Non-selective autophagy (using appropriate markers)

    • ATG32 should specifically affect mitophagy without altering other pathways

  • Core autophagy machinery dependence:

    • Include atg1Δ controls to confirm dependence on core autophagy machinery

    • This distinguishes authentic autophagy from other degradation pathways

  • Mitochondrial functionality controls:

    • Assess mitochondrial function parameters (respiration, membrane potential)

    • Monitor mitochondrial DNA levels and protein markers like F1-β

    • These should be normal in atg32Δ cells under non-inducing conditions

  • Protein interaction specificity controls:

    • Use mutated binding interfaces to confirm specificity of interactions

    • For example, ATG32 AQAA and ATG8 P52A/R67A mutations to test AIM-mediated binding

These control experiments collectively ensure that observed phenotypes are specifically attributable to ATG32-mediated mitophagy rather than general autophagy defects or non-specific cellular responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.