Recombinant Ashbya gossypii Chitin synthase export chaperone (CHS7)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chitin Biosynthesis

CHS7 acts as a molecular chaperone for CHS3, a class III chitin synthase responsible for synthesizing β-1,3-glucan and chitin. Key functions include:

  • ER Export: Ensures correct folding and trafficking of CHS3 from the ER to the plasma membrane .

  • Cell Wall Integrity: Defects in CHS7 disrupt septation and chitin deposition, leading to isotropic hyphal growth and swollen morphologies .

  • Hyphal Tip Organization: Localizes actin cables and endosomal vesicles at hyphal tips, critical for polarized growth .

Biotechnological Applications

ApplicationDetailsSource
Recombinant Protein ProductionCHS7’s interaction with CHS3 may influence secretion efficiency in engineered A. gossypii strains producing heterologous proteins (e.g., β-galactosidase) .
Metabolic EngineeringCHS7’s regulation of chitin synthesis could be leveraged to optimize cell wall integrity in strains engineered for single-cell oils or flavor compounds .

Gene Information

Gene NameLocusFamilySpecies
CHS7AFR033CCHS7 familyAshbya gossypii

Expression Systems

CHS7 is typically expressed in E. coli with His-tag purification. Alternative hosts (e.g., yeast, mammalian cells) have been explored but are less common .

Challenges and Future Directions

  • Secretion Efficiency: While A. gossypii secretes native enzymes efficiently, recombinant protein yields remain low. CHS7’s optimization may require co-expression with CHS3 or ER chaperones .

  • Industrial Relevance: CHS7’s role in chitin biosynthesis positions it as a target for improving hyphal morphology in riboflavin-producing strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHS7; AFR033C; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
CHS7
Target Protein Sequence
MSSKEAPMRAWLKMAGLAMSNKSWLSLGDFAGICAKTPLPMCFVVQTSSLPGGSVGATHY DRTHMNIGMVPRCYSRTVDIANTAIFQLGNAFVNILALCVILIISYNIRFKYTAIGRSEY GYFFQLCFMLICMTLVVDCGVSPPGTLAYPYLAALQIGLAGACSWALAVMGFLGFRLWED GTRKSMLIVRGVSMVGFLLGSLVSAITFTNWIQHHPDMKTNTTALFVVMYGLNGLALLMY SVCQLVVSIFVLSNFWMTGSTILGVIFITTGQVLMYTISYEICEGVKHYLDGLFIGSICN VFALMMIYKTWDISTDEDLEFSVSISVDGDIMYNSNLKL
Uniprot No.

Target Background

Function
This chaperone is essential for the export of the chitin synthase CHS3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How is recombinant Ashbya gossypii CHS7 protein typically produced for research?

Recombinant A. gossypii CHS7 protein is commonly produced using E. coli expression systems. The typical production process involves:

  • Cloning the full-length CHS7 gene (encoding amino acids 1-339) into an appropriate expression vector

  • Adding an N-terminal His tag for purification purposes

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the recombinant protein using affinity chromatography

  • Lyophilizing the purified protein for long-term storage

The resulting protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For research applications, the protein is reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, often with the addition of 5-50% glycerol for long-term storage at -20°C to -80°C .

What experimental techniques are used to study CHS7-chitin synthase interactions?

Several experimental approaches are employed to study the interactions between CHS7 and chitin synthases:

  • Co-immunoprecipitation (Co-IP): Used to detect physical interactions between CHS7 and chitin synthases in cell lysates.

  • Fluorescence microscopy: By tagging CHS7 and chitin synthases with different fluorescent proteins, researchers can track their co-localization in cells.

  • Yeast two-hybrid assays: Used to identify specific domains involved in protein-protein interactions.

  • In vitro binding assays: With purified recombinant proteins to assess direct interactions.

  • Mutational analysis: Creating point mutations or truncations in CHS7 to identify domains critical for interaction with chitin synthases.

Studies have demonstrated that CHS7 forms a stable complex with Chs3, and this interaction extends beyond the ER to include localization at the bud neck and in intracellular compartments . Research has identified mutations in the C-terminal cytosolic domain of CHS7 that affect its association with Chs3 at post-ER transport steps without impairing its chaperone function .

How does CHS7 regulate both folding and activity of chitin synthases?

CHS7 exhibits dual functionality in its relationship with chitin synthases, particularly Chs3. Experimental evidence indicates that CHS7 engages in functionally distinct interactions with Chs3 at different cellular locations:

  • ER folding and transport function: In the ER, CHS7 prevents Chs3 aggregation by facilitating proper folding of this polytopic membrane protein. Without CHS7, Chs3 forms high molecular weight aggregates and is retained in the ER.

  • Post-ER regulatory function: Beyond facilitating ER exit, CHS7 remains associated with Chs3 during transport to the cell surface. Mutations in the C-terminal cytosolic domain of CHS7 that disrupt this continued association do not prevent Chs3 trafficking to the plasma membrane but significantly reduce its catalytic activity .

This dual role suggests that CHS7 first ensures proper folding and ER exit of Chs3, and subsequently modulates its enzymatic activity at the plasma membrane. The molecular mechanism of this activity regulation remains an active area of research, but may involve conformational changes in the Chs3 protein induced by its continued association with CHS7 .

What is the comparative analysis of CHS7 function across different fungal species?

CHS7 function has been studied in several fungal species, revealing both conserved and species-specific aspects:

SpeciesCHS7 SizeKey FunctionsExperimental SystemsReference
Ashbya gossypii339 aaChitin synthase chaperoneE. coli expression, recombinant protein studies
Saccharomyces cerevisiaeSimilar to A. gossypiiForms stable complex with Chs3; affects both folding and activityMutational analysis, fluorescence microscopy
Sordaria macrosporaHomolog presentDevelopmentally regulatedGene knockout, RT-qPCR

In S. cerevisiae, CHS7 is an ER resident protein that exits the ER with Chs3 and localizes to the bud neck and intracellular compartments. Functional studies in S. macrospora have shown that chs7 is developmentally regulated, suggesting potential species-specific roles in fungal development .

The gene knockout techniques developed for studying chs7 in S. macrospora involve:

  • Amplification of flanking regions of chs7

  • Introduction of a hygromycin resistance cassette

  • Homologous recombination in S. cerevisiae

  • Transformation into S. macrospora

  • Verification through PCR and Southern blot analysis

How do mutations in the CHS7 C-terminal domain affect its chaperone function versus its activity regulation?

Research has revealed a functional distinction between different domains of the CHS7 protein:

  • Main body domains: Critical for the primary chaperone function, facilitating proper folding and preventing aggregation of chitin synthases in the ER.

  • C-terminal cytosolic domain: Essential for maintaining association with chitin synthases during post-ER transport and for regulating enzymatic activity at the plasma membrane.

Experimental studies have identified specific mutations in the CHS7 C-terminal domain that do not impair the protein's ability to facilitate chitin synthase folding and ER exit but cause dissociation from chitin synthases during later transport steps. These mutations result in properly localized but catalytically compromised chitin synthases at the cell surface .

This functional separation suggests that:

  • Different structural elements of CHS7 mediate distinct functions

  • The continued association of CHS7 with chitin synthases beyond the ER is critical for enzymatic activity

  • CHS7 may function as an activator or cofactor for chitin synthases at their final destinations

These findings have significant implications for understanding how accessory proteins can influence both the folding/transport and the ultimate activity of their client proteins.

What methodologies are recommended for studying the genomic context of CHS7 in newly isolated Ashbya strains?

For researchers studying CHS7 in newly isolated Ashbya strains, several methodologies are recommended:

  • High-coverage short-read sequencing: This approach has been successfully used to analyze different Ashbya isolates, including a Florida strain that showed 99.9% genome identity with the reference strain .

  • Phylogenetic analysis using rDNA-ITS sequences: This method has proven effective for establishing evolutionary relationships among Ashbya isolates from different geographical regions .

  • Comparative genomics: The extensive synteny between A. gossypii and S. cerevisiae genomes provides a valuable framework for analyzing CHS7 and related genes .

  • RT-qPCR for expression analysis: Standard protocols using oligonucleotide primers specific for CHS7 can be used to study expression patterns across different developmental stages or in response to various stimuli .

  • Gene knockout strategies: Techniques involving flanking region amplification, resistance cassette introduction, and homologous recombination have been established for functional analysis of genes in Ashbya species .

When studying Ashbya strains isolated from insects, it's important to note that recent genomic analyses have revealed four rather than three mating type loci in all strains, which represents an evolutionary puzzle compared to S. cerevisiae .

What are the technical challenges in expression and purification of functional recombinant CHS7 for in vitro studies?

Producing functional recombinant CHS7 for in vitro studies presents several technical challenges:

  • Membrane protein solubility: As a membrane-localized protein, CHS7 contains multiple hydrophobic regions that can cause aggregation during expression and purification.

  • Proper folding: Ensuring correct folding of the recombinant protein, particularly when expressed in prokaryotic systems like E. coli that lack the eukaryotic folding machinery.

  • Post-translational modifications: If CHS7 requires specific post-translational modifications for function, these may be absent in bacterial expression systems.

  • Stability concerns: Purified CHS7 requires careful handling to maintain stability, with recommendations against repeated freeze-thaw cycles .

  • Reconstitution requirements: For functional studies, CHS7 may need to be reconstituted in appropriate membrane mimetics such as detergent micelles, liposomes, or nanodiscs.

Recommended approaches to address these challenges include:

  • Expression with solubility-enhancing tags (His tag is commonly used)

  • Storage in buffers containing stabilizers like trehalose (6% trehalose has been used successfully)

  • Reconstitution at controlled concentrations (0.1-1.0 mg/mL) with added glycerol (5-50%) for stability

  • Storage as aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

How can CHS7 research inform the development of novel antifungal strategies?

CHS7 research offers promising avenues for antifungal drug development for several reasons:

  • Essential role in chitin synthesis: As chitin is absent in mammals but essential for fungal cell wall integrity, the CHS7-dependent pathway represents a selective target.

  • Specificity advantage: Targeting CHS7 rather than chitin synthases directly might provide greater species specificity, potentially reducing off-target effects on beneficial fungi.

  • Multiple intervention points: The dual role of CHS7 in both folding/transport and activity regulation offers two distinct mechanisms for therapeutic intervention.

  • Potential for broad-spectrum activity: Conservation of CHS7 function across multiple fungal species suggests the possibility of developing broad-spectrum antifungals targeting this pathway.

Future research directions should explore:

  • Small molecule inhibitors that disrupt specific CHS7-chitin synthase interactions

  • Peptide-based approaches targeting the C-terminal domain of CHS7 to affect enzyme regulation

  • Screens for compounds that destabilize the CHS7-Chs3 complex at the cell surface

  • Exploration of species-specific variations in CHS7 structure that might allow selective targeting of pathogenic fungi

What experimental designs are optimal for studying the kinetics of CHS7-mediated chitin synthase activation?

To study the kinetics of CHS7-mediated chitin synthase activation, researchers should consider the following experimental designs:

  • In vitro reconstitution systems:

    • Purified recombinant CHS7 and chitin synthases in appropriate membrane mimetics

    • Real-time monitoring of chitin synthesis activity with and without CHS7

    • Variation of CHS7:chitin synthase ratios to determine stoichiometry requirements

  • Structure-function studies:

    • Create a library of CHS7 mutants with modifications in different domains

    • Assess both binding affinity to chitin synthases and ability to activate enzyme function

    • Use techniques such as hydrogen-deuterium exchange mass spectrometry to identify conformational changes induced by CHS7 binding

  • Inducible expression systems:

    • Develop cell systems with inducible CHS7 expression to study the temporal aspects of chitin synthase activation

    • Monitor chitin synthesis rates following CHS7 induction

    • Correlate with cellular localization using fluorescently tagged proteins

  • Quantitative binding assays:

    • Surface plasmon resonance or microscale thermophoresis to determine binding constants

    • Competition assays to identify critical interaction domains

    • Investigation of potential cofactors that might influence binding kinetics

Research has shown that mutations preventing continued association of CHS7 with Chs3 dramatically reduce catalytic activity without blocking delivery to the cell surface, suggesting a direct role in enzyme activation rather than just localization .

How does the evolutionary relationship between A. gossypii and S. cerevisiae inform our understanding of CHS7 function?

The evolutionary relationship between A. gossypii and S. cerevisiae provides valuable insights into CHS7 function:

  • Genome synteny: The extensive synteny between these two fungal genomes facilitates comparative analysis of CHS7 and related genes .

  • Functional conservation: Despite evolutionary divergence, both species utilize CHS7 as a dedicated chaperone for chitin synthases, indicating strong selective pressure to maintain this function .

  • Morphological differences: A. gossypii is filamentous while S. cerevisiae is predominantly unicellular, suggesting potential adaptations in cell wall biogenesis pathways, including CHS7-dependent processes.

  • Mating type complexity: Recent genomic analysis revealed four mating type loci in A. gossypii compared to three in S. cerevisiae, adding a new evolutionary puzzle that may indirectly affect regulation of cell wall formation pathways .

Evolutionary analysis suggests that:

  • Core functions of CHS7 in chitin synthase folding and transport are highly conserved

  • Species-specific variations may reflect adaptations to different ecological niches

  • Regulatory networks controlling CHS7 expression might differ between filamentous and unicellular fungi

  • The relationship between mating type complexity and cell wall biogenesis represents an unexplored area for future research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.