Recombinant Ashbya gossypii CTP-dependent diacylglycerol kinase 1 (DGK1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Kinetics

DGK1 exhibits distinct biochemical characteristics:

ParameterValue
Phosphate DonorCTP (apparent K<sub>m</sub> = 0.3 mM); dCTP also serves as a substrate (K<sub>m</sub> = 0.4 mM)
Optimal pH7.0–7.5
Cation RequirementCa<sup>2+</sup> or Mg<sup>2+</sup>
Thermal StabilityLabile above 40°C
InhibitorsN-ethylmaleimide, CDP-diacylglycerol, sphingoid bases
Substrate CooperativityPositive cooperative kinetics for DAG (Hill coefficient = 2.5; apparent K<sub>m</sub> = 6.5 mol%)

Phospholipids like phosphatidylethanolamine enhance activity, while CDP-diacylglycerol suppresses it .

Functional Role in Lipid Metabolism

In Ashbya gossypii, DGK1 regulates phospholipid biosynthesis via the Kennedy pathway by recycling DAG into phosphatidate, a precursor for phosphatidylinositol and phosphatidylglycerol . Key functional insights include:

  • Metabolic Engineering: A. gossypii strains lacking DGK1 cannot synthesize phospholipids when de novo fatty acid synthesis is impaired, highlighting its role in lipid homeostasis .

  • Species-Specific Absence: Unlike Saccharomyces cerevisiae or Kluyveromyces lactis, A. gossypii retains DGK1, enabling DAG utilization under nutrient-limited conditions .

Applications in Industrial and Academic Research

Recombinant DGK1 is utilized in:

  • Lipidomics Studies: Elucidating CTP-dependent lipid phosphorylation mechanisms in eukaryotes .

  • Enzyme Engineering: Structure-function analyses to optimize thermal stability or substrate specificity .

  • Metabolic Modeling: Integrating DGK1 kinetics into genome-scale models of A. gossypii for riboflavin production optimization .

Research Limitations and Future Directions

Current challenges include:

  • Thermal Instability: Activity loss above 40°C limits industrial applications .

  • Regulatory Mechanisms: Unknown post-translational modifiers affecting DGK1 activity in vivo.
    Future work may focus on directed evolution to enhance stability or engineer ATP compatibility for broader biotechnological use .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time information, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
DGK1; HSD1; AFR329C; CTP-dependent diacylglycerol kinase 1; Diglyceride kinase 1; DAG kinase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
DGK1
Target Protein Sequence
MANEEELQTAESAFVTGARRYSNDYSESESSSKHSGCSTPVEGTPAEAATTIGARASGGS TTWQRLRQLLMERGSDVHLPVTEIHLKSQEWFGDFITKHEVPRKVFHSSIGFFTLALYVR DVDYRNVRLPLIVGFVHVLLLDVIRLHWPAFNTLYCQVTGLLMRKKEVHTYNGVLWYLLG LIFAFSFFSKDVALVSLFLLSWCDTAASTVGRLYGHLTPRISRNKSLAGSLAAFVVGVIS CAVFYGYFVPAYSHVNHPGEIMWNPETSRLSLVQLSLLGGFVASLSEGIDLFNWDDNFTI PVLSAIFMHTIIAFSQR
Uniprot No.

Target Background

Function
CTP-dependent diacylglycerol kinase catalyzes the phosphorylation of diacylglycerol (DAG) to phosphatidate (PA). It regulates phosphatidate levels at the nuclear envelope and may be involved in vesicle trafficking between the endoplasmic reticulum and the Golgi apparatus.
Database Links
Protein Families
DGK1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it used as a model organism in recombinant protein studies?

Ashbya gossypii is a filamentous fungus initially identified as a cotton pathogen transmitted by insects. It has gained significant importance in research due to several advantageous characteristics:

  • It possesses extensive synteny with the Saccharomyces cerevisiae genome (greater than 90% synteny of protein-coding genes), making it valuable for comparative genomic studies

  • Unlike many other filamentous fungi, it follows homologous recombination as the rule rather than the exception, facilitating genetic manipulation

  • It grows in a strictly filamentous mode with multinucleated and multibranching hyphae while maintaining a budding yeast-like genome, offering unique research opportunities

  • It is commercially exploited as a natural overproducer of vitamin B2 (riboflavin), demonstrating practical applications beyond basic research

These characteristics make A. gossypii an excellent model system for studying recombinant protein expression, including enzymes involved in lipid metabolism such as diacylglycerol-related enzymes.

What are the optimal storage conditions for recombinant A. gossypii proteins?

Based on established protocols for recombinant A. gossypii proteins, the following storage conditions are recommended:

  • Store lyophilized protein powder at -20°C to -80°C upon receipt

  • For reconstituted proteins, aliquoting is necessary to avoid repeated freeze-thaw cycles

  • Short-term storage (up to one week) of working aliquots can be maintained at 4°C

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal) and store at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity

These storage guidelines help maintain protein stability and enzymatic activity for extended periods.

How should recombinant A. gossypii proteins be reconstituted for experimental use?

Proper reconstitution is critical for maintaining protein function. The recommended protocol includes:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term stability, add glycerol to a final concentration of 5-50%

  • When preparing working solutions, use appropriate buffers that maintain optimal pH (typically Tris/PBS-based buffer at pH 8.0)

  • Filter sterilize if needed for cell culture experiments

  • Validate protein activity after reconstitution using appropriate assays

This methodical approach ensures maximal retention of enzymatic activity and protein stability.

What are the critical functional domains in diacylglycerol-metabolizing enzymes and how do they affect experimental design?

Diacylglycerol-metabolizing enzymes possess several conserved functional domains that are crucial for their activity. Based on structural analysis of related enzymes, the following domains are particularly important:

  • Cysteine-rich domains (CRDs): Research on related DGK enzymes shows that the second and third CRDs are critical for terminating diacylglycerol signaling in vivo

  • Kinase domain: Essential for the catalytic activity of DGK enzymes

  • Pleckstrin homology domain: Important for membrane targeting and substrate recognition

When designing experiments with recombinant diacylglycerol-metabolizing enzymes, researchers should consider:

  • Preserving the integrity of these domains during cloning and expression

  • Designing mutations that target specific residues within these domains to study structure-function relationships

  • Including appropriate controls to verify domain functionality

  • Using domain-specific inhibitors to elucidate mechanistic details

The amino acid sequence of recombinant A. gossypii DGA1 reveals potential functional domains that must be preserved during experimental manipulation to maintain enzymatic activity .

How can experimental research design approaches be optimized for studying recombinant A. gossypii enzymes?

Effective experimental design is crucial for generating reliable and reproducible results when working with recombinant enzymes. Consider the following methodological approaches:

  • Variable identification and control:

    • Establish clear independent and dependent variables

    • Maintain consistent experimental conditions (temperature, pH, buffer composition)

    • Use two sets of variables where the first set acts as a constant to measure differences in the second set

  • Causality establishment:

    • Design experiments where time is a factor in establishing cause-effect relationships

    • Focus on invariable behaviors between cause and effect

    • Include appropriate controls to validate causal relationships

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Plan for statistical analyses that match your experimental design

    • Include biological and technical replicates to account for variability

  • Optimization strategies:

    • Use factorial design to simultaneously test multiple variables

    • Implement response surface methodology to optimize enzymatic conditions

    • Consider Taguchi methods for robust parameter design

This systematic approach helps researchers execute their objectives with clarity and transparency, leading to more reliable and reproducible results .

What are the key methodological considerations when comparing enzymatic activities of different recombinant diacylglycerol-metabolizing enzymes?

When comparing the activities of different recombinant diacylglycerol-metabolizing enzymes, researchers should consider these critical methodological factors:

  • Protein purity assessment:

    • Verify protein purity (>90%) using SDS-PAGE or other appropriate methods

    • Ensure batch-to-batch consistency through quality control measures

    • Document any contaminants that might affect activity measurements

  • Standardization of assay conditions:

    • Maintain consistent substrate concentrations

    • Control temperature, pH, and ionic strength

    • Use identical buffer systems when possible

    • Standardize enzyme concentrations based on active site titration rather than total protein

  • Kinetic parameter determination:

    • Measure initial reaction rates under substrate-saturating conditions

    • Determine Km, Vmax, and kcat values using appropriate models

    • Account for potential product inhibition

    • Consider allosteric effects where relevant

  • Analytical validation:

    • Use multiple detection methods to confirm activity (e.g., spectrophotometric, chromatographic)

    • Implement internal standards for quantitative measurements

    • Validate assay linearity, precision, and accuracy

These considerations ensure meaningful comparisons between different enzyme preparations and accurate interpretation of experimental results.

What are common issues encountered when expressing recombinant A. gossypii proteins in E. coli and how can they be resolved?

Expression of recombinant A. gossypii proteins in E. coli can present several challenges. Here are common issues and their solutions:

  • Poor expression levels:

    • Optimize codon usage for E. coli

    • Test different promoter systems (T7, trc, araBAD)

    • Adjust induction conditions (temperature, inducer concentration, duration)

    • Screen multiple E. coli strains (BL21(DE3), Rosetta, Origami)

  • Protein insolubility:

    • Lower induction temperature (15-25°C)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Use solubility-enhancing fusion tags (MBP, SUMO, TrxA)

    • Consider refolding from inclusion bodies if necessary

  • Improper folding/low activity:

    • Include relevant cofactors in the growth medium

    • Test different cell lysis methods to preserve protein structure

    • Optimize buffer conditions during purification

    • Validate protein folding using circular dichroism or other structural analyses

  • Proteolytic degradation:

    • Use protease-deficient strains

    • Include protease inhibitors during purification

    • Optimize purification speed to minimize exposure time

    • Store proteins with stabilizing agents

Addressing these challenges methodically can significantly improve the yield and quality of recombinant A. gossypii proteins expressed in E. coli .

How can researchers validate the structural integrity and enzymatic activity of recombinant diacylglycerol-metabolizing enzymes?

Comprehensive validation of recombinant enzymes requires assessment of both structural integrity and functional activity:

  • Structural validation methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to verify domain folding

    • Size exclusion chromatography to confirm oligomeric state

    • Mass spectrometry for accurate mass determination and post-translational modifications

  • Functional validation approaches:

    • Substrate-specific activity assays

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Inhibitor sensitivity profiles compared to native enzymes

    • pH and temperature optima characterization

    • Cofactor dependency analysis

  • Comparative analysis:

    • Benchmark against commercially available enzymes

    • Compare with literature values for similar enzymes

    • Evaluate performance in standardized reaction conditions

  • Application-specific validation:

    • Test enzyme performance in relevant biological matrices

    • Assess stability under actual experimental conditions

    • Verify reproducibility across different enzyme batches

This multi-faceted validation approach ensures that recombinant enzymes maintain native-like properties and provides confidence in experimental results.

How can genome comparison studies between different Ashbya isolates inform our understanding of diacylglycerol metabolism enzyme evolution?

Comparative genomic analysis of Ashbya isolates provides valuable insights into the evolution of lipid metabolism enzymes:

  • Evolutionary conservation analysis:

    • Compare synteny of diacylglycerol metabolism genes across Ashbya species

    • Identify conserved domains that withstand evolutionary pressure

    • Detect species-specific adaptations in catalytic or regulatory domains

  • Gene duplication and specialization:

    • Analyze tandem gene duplications that may enhance metabolic capabilities

    • Investigate functional divergence following duplication events

    • Assess the preservation of ancestral functions versus neofunctionalization

  • Regulatory element evolution:

    • Compare promoter regions to identify conserved transcription factor binding sites

    • Analyze intergenic regions for regulatory motifs

    • Detect differences in expression patterns across species

  • Metabolic network context:

    • Map enzyme variations to metabolic pathway differences

    • Correlate genomic changes with alterations in lipid profiles

    • Assess the impact of environmental adaptations on diacylglycerol metabolism

These comparative approaches can reveal how diacylglycerol metabolism enzymes evolved in response to different ecological niches and physiological demands .

What are the methodological approaches for investigating the role of specific amino acid residues in diacylglycerol-metabolizing enzyme function?

Investigating the functional significance of specific amino acid residues requires systematic approaches:

  • Structure-guided mutagenesis:

    • Target highly conserved residues across species

    • Focus on amino acids in catalytic domains, substrate binding sites, and regulatory regions

    • Create single-point mutations using site-directed mutagenesis

    • Generate systematic alanine scanning libraries

  • Functional characterization of mutants:

    • Compare kinetic parameters (Km, kcat, substrate specificity)

    • Assess protein stability and folding changes

    • Analyze membrane association or protein-protein interactions

    • Evaluate responses to regulatory molecules

  • Structural analysis integration:

    • Use homology modeling to predict structural consequences of mutations

    • Where possible, obtain crystal structures of wild-type and mutant proteins

    • Implement molecular dynamics simulations to assess dynamic effects of mutations

  • Physiological validation:

    • Test mutant enzymes in cellular contexts

    • Assess the ability to complement knockout strains

    • Measure metabolic fluxes in reconstituted systems

Studies on related enzymes have shown that substitutions in cysteine-rich domains and kinase domains can significantly impair physiological functions, demonstrating the importance of these regions for enzyme activity .

How can researchers design experiments to elucidate the regulatory mechanisms of diacylglycerol-metabolizing enzymes in Ashbya gossypii?

Elucidating regulatory mechanisms requires multi-faceted experimental approaches:

  • Transcriptional regulation analysis:

    • Implement reporter gene assays to identify regulatory elements

    • Use chromatin immunoprecipitation (ChIP) to detect transcription factor binding

    • Employ RNA-seq to analyze expression patterns under different conditions

    • Develop inducible expression systems to control enzyme levels

  • Post-translational modification mapping:

    • Use mass spectrometry to identify phosphorylation, acetylation, or other modifications

    • Create modification-mimicking mutations (e.g., S→D for phosphorylation)

    • Employ specific inhibitors of modifying enzymes

    • Develop antibodies against specific modified forms

  • Protein-protein interaction studies:

    • Perform yeast two-hybrid or co-immunoprecipitation experiments

    • Implement proximity labeling techniques (BioID, APEX)

    • Use fluorescence resonance energy transfer (FRET) to detect interactions in vivo

    • Apply split-reporter systems to visualize interactions in living cells

  • Metabolic regulation investigation:

    • Measure enzyme activity in response to metabolic intermediates

    • Implement metabolic flux analysis to trace carbon flow

    • Develop biosensors for real-time activity monitoring

    • Use competitive inhibitors to probe allosteric regulation

These methodological approaches provide a comprehensive framework for understanding the complex regulatory mechanisms governing diacylglycerol metabolism in A. gossypii.

How do findings from Ashbya gossypii diacylglycerol metabolism studies translate to other filamentous fungi and yeasts?

Translating research findings across fungal species requires careful consideration of evolutionary relationships and physiological differences:

  • Phylogenetic context analysis:

    • Compare enzyme sequences across fungal lineages to identify orthologous relationships

    • Assess conservation of key functional domains

    • Evaluate species-specific insertions or deletions

    • Consider the impact of whole-genome duplication events

  • Functional conservation testing:

    • Express A. gossypii enzymes in other fungi to test cross-species functionality

    • Compare kinetic parameters of orthologous enzymes

    • Assess substrate preferences across species

    • Analyze the ability to complement gene deletions across species

  • Regulatory network comparison:

    • Map transcriptional networks controlling diacylglycerol metabolism

    • Identify conserved versus species-specific regulatory mechanisms

    • Compare stress responses affecting lipid metabolism

    • Analyze metabolic adaptation strategies

  • Metabolic pathway integration:

    • Compare the organization of lipid metabolism pathways

    • Identify alternative routes for diacylglycerol processing

    • Assess the physiological significance of pathway differences

    • Evaluate the impact on growth characteristics and stress responses

The extensive synteny between A. gossypii and S. cerevisiae genomes (>90%) provides a strong foundation for comparative studies, while recognizing that A. gossypii's filamentous growth pattern may introduce unique aspects to lipid metabolism regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.