Recombinant Ashbya gossypii Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Background and Function of COX2

Cytochrome c oxidase is the terminal enzyme of the mitochondrial respiratory chain, playing a vital role in oxidative phosphorylation. The COX2 subunit, encoded by the mitochondrial DNA, is essential for the proper assembly and function of the cytochrome c oxidase complex. In Ashbya gossypii, COX2 is one of the mtDNA-encoded proteins that have been studied extensively due to its role in mitochondrial function and its involvement in unique genetic code reassignments.

Genetic Code Reassignment in Ashbya gossypii Mitochondria

In the mitochondria of Ashbya gossypii, there is a notable reassignment of the CUU and CUA codons from leucine (Leu) to alanine (Ala) . This reassignment is significant because it deviates from the standard genetic code and highlights the dynamic nature of genetic codes in mitochondria. The reassignment is confirmed by mass spectrometry, which shows that peptides containing these codons are translated as alanine rather than leucine or threonine, as seen in other organisms .

Research Findings on COX2 in Ashbya gossypii

Research on Ashbya gossypii COX2 has focused on its role in mitochondrial function and the implications of codon reassignment. For instance, the study of COX2 peptides has provided evidence for the CUU and CUA codon reassignment to alanine . Additionally, the analysis of mitochondrial tRNA and aminoacyl-tRNA synthetases has shed light on how these codons are recognized and translated correctly in Ashbya gossypii mitochondria .

Comparison with Other Organisms

In comparison to other fungi like Saccharomyces cerevisiae, Ashbya gossypii exhibits unique genetic and biochemical features. For example, while Saccharomyces cerevisiae mitochondria translate CUA as threonine, Ashbya gossypii translates it as alanine . This difference underscores the variability in mitochondrial genetic codes across species.

Data and Tables

While specific data tables for recombinant Ashbya gossypii COX2 are not readily available, research findings highlight the importance of codon reassignment and mitochondrial function. For instance, the reassignment of CUU and CUA codons affects the translation of several mitochondrial proteins, including COX2 .

CodonStandard Genetic CodeAshbya gossypii Mitochondria
CUULeucineAlanine
CUALeucineAlanine

References

  1. Ling, J., Daoud, R., Lajoie, M. J., Church, G. M., Söll, D., & Lang, B. F. (2014). Natural reassignment of CUU and CUA sense codons to alanine in Ashbya mitochondria. Nucleic Acids Research, 42(1), 499–508. doi: 10.1093/nar/gkt842

  2. Molecular Determinants of Sporulation in Ashbya gossypii (2013).

  3. Tumor-derived cyclooxygenase-2 fuels hypothalamic inflammation (2024).

  4. Alteration of a Novel Dispensable Mitochondrial Ribosomal Small Subunit Protein (2005).

  5. Fungal Abstract Book 2015.

  6. Overexpression of the COX2 translational activator, Pet111p (2005).

  7. New biotechnological applications for Ashbya gossypii.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; CoxII; AMI001W; AgCOX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-248
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
COX2
Target Protein Sequence
DVPTPYNMYFQDSTTPHQEGILELHDNIMFYMLTVLGLVSWMMIIIIKDYKNNPITYKYI KHGQMIEIIWTILPAIILLMIAFPSFILLYLCDEVISPAMTIKVIGLQWYWKYEYSDFIN DNGETIEYESYMIPEELLEEGQLRMLDTDTSIVIPVDTHVRFIVTATDVIHDFAVPSLGI KIDTTPGRLSQVSTLIQREGIFYGQCSELCGAQHSAMPIKIETVKLPTFLTWLNEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives both transmembrane transport and ATP synthase activity. COX2 plays a crucial role within CIV, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the Cu(A) center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and Cu(B). The BNC facilitates the reduction of molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (COX2) in Ashbya gossypii?

Cytochrome c oxidase subunit 2 (COX2) in Ashbya gossypii is a key component of the respiratory chain that catalyzes the reduction of oxygen to water. This mitochondrially-encoded protein functions by transferring electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1. COX2 in A. gossypii is particularly notable for containing amino acids resulting from a unique mitochondrial genetic code where CUU and CUA codons are reassigned from leucine to alanine . The protein consists of 248 amino acids with a molecular weight of approximately 28.7 kDa .

Why is A. gossypii important as a biotechnological organism?

Ashbya gossypii has emerged as a significant biotechnological organism for several reasons:

  • Industrial riboflavin production: A. gossypii has been used by BASF since 1990 for commercial riboflavin (vitamin B2) production, replacing chemical synthesis with a more economical and sustainable bioprocess .

  • Extensive molecular toolbox: Its industrial relevance has driven the development of sophisticated molecular and in silico modeling tools for genetic manipulation .

  • Genomic advantages: The availability of its genome sequence and metabolism knowledge facilitates effective metabolic engineering strategies .

  • Versatile applications: Beyond riboflavin, A. gossypii has shown potential for producing recombinant proteins, single cell oils (SCOs), and flavor compounds .

These characteristics make A. gossypii an increasingly valuable organism for various biotechnological applications, including recombinant protein production.

What is the significance of the CUU and CUA codon reassignment in A. gossypii mitochondria?

The reassignment of CUU and CUA codons from leucine to alanine in A. gossypii mitochondria represents a rare natural genetic code alteration with significant research implications:

  • Evolutionary uniqueness: This codon reassignment differs from both the standard genetic code (where CUU/CUA encode leucine) and from related fungi like Saccharomyces cerevisiae (where mitochondrial CUN codons encode threonine) .

  • Protein structural adaptation: Multiple sequence alignment of conserved positions in mitochondrial proteins shows that where other organisms have leucine or threonine, A. gossypii has alanine, indicating evolutionary adaptation to maintain protein function despite amino acid substitutions .

  • Experimental validation: Mass spectrometry analysis of mitochondrial proteins, including COX2, has confirmed that CUA codons are translated as alanine in vivo .

  • Molecular mechanism: The reassignment involves a mitochondrial tRNA that is accurately processed and recognized by A. gossypii mitochondrial alanyl-tRNA synthetase (AgAlaRS) .

This codon reassignment creates unique challenges and opportunities for recombinant expression of A. gossypii mitochondrial proteins like COX2.

How does the expression of COX2 correlate with riboflavin production in A. gossypii?

The relationship between COX2 expression and riboflavin production involves complex regulatory interactions:

  • Shared regulatory elements: Research has shown that ectopic expression of Saccharomyces cerevisiae MATα2 in A. gossypii simultaneously suppresses sporulation, inhibits riboflavin overproduction, and downregulates factors like AgSOK2 .

  • APSES transcription factor role: AgSok2 (a target of the cAMP/protein kinase A pathway) serves as a central positive regulator for sporulation and influences riboflavin production, suggesting coordinated control of these processes .

  • Metabolic connections: As a respiratory chain component, COX2 influences cellular energy metabolism, which may affect the resources available for riboflavin biosynthesis.

  • Developmental timing: A. gossypii naturally overproduces riboflavin and fragments its mycelium into spore-producing sporangia at the end of a growth phase, indicating coordinated regulation of metabolism and development .

Understanding these connections could provide insights for metabolic engineering strategies to enhance both respiratory efficiency and riboflavin production in A. gossypii.

What methodologies are most effective for recombinant expression of A. gossypii COX2?

Based on research with A. gossypii recombinant protein expression, the following methodological approaches are recommended:

Methodology ComponentRecommended ApproachImprovement FactorReference
Promoter selectionNative A. gossypii promoters (AgTEF, AgGPD) instead of S. cerevisiae promotersUp to 8-fold improvement
Terminator considerationRemove sequences with autonomous replicating activity (e.g., ScADH1)2-fold improvement
Carbon sourceGlycerol instead of glucose1.5-fold higher production
Codon optimizationAccount for CUU/CUA→Ala reassignment in heterologous systemsEssential for functional expression
Expression verificationMass spectrometry to confirm correct amino acid incorporationNecessary quality control

For COX2 specifically, additional considerations include:

  • Membrane protein expression techniques to ensure proper folding and insertion

  • Methods for copper center formation and verification

  • Solubilization strategies compatible with maintaining native structure and function

These approaches should be adapted based on specific research goals and expression systems.

How can site-directed mutagenesis reveal the functional significance of unique alanine residues in A. gossypii COX2?

Site-directed mutagenesis provides a powerful tool for investigating the functional adaptation of A. gossypii COX2 to its unique amino acid composition:

  • Strategic mutation targets:

    • Alanine residues derived from reassigned CUU/CUA codons, especially those in conserved positions

    • Residues involved in copper center formation and electron transfer

    • Amino acids at interfaces with other cytochrome c oxidase subunits

  • Experimental approach:

    • Generate Ala→Leu or Ala→Thr mutations to mimic sequences found in standard or yeast mitochondrial genetic codes

    • Express both wild-type and mutant proteins using optimized expression systems

    • Compare structural stability, copper binding, and catalytic activity

  • Functional analysis methods:

    • Oxygen consumption assays to measure catalytic efficiency

    • Spectroscopic techniques to assess copper center integrity

    • Protein-protein interaction studies to evaluate subunit assembly

This approach can reveal how A. gossypii COX2 has adapted its structure and function to accommodate the alanine residues resulting from genetic code evolution, providing insights into protein adaptability and mitochondrial evolution.

What challenges arise in heterologous expression of A. gossypii COX2 due to the unique codon usage?

The unique mitochondrial genetic code of A. gossypii creates several challenges for heterologous expression:

  • Amino acid misincorporation: In standard expression systems, CUU and CUA codons encode leucine rather than alanine, resulting in incorrect amino acid incorporation at critical positions .

  • Structural implications: Substituting small alanine residues with bulkier leucine affects protein folding, potentially disrupting functional domains and interactions.

  • Functional consequences: Incorrect amino acid incorporation can impair copper binding, electron transfer, and interactions with other cytochrome c oxidase subunits.

ChallengeSolution StrategyVerification Method
Incorrect amino acid incorporationCodon optimization replacing CUU/CUA with standard alanine codons (GCN)Mass spectrometry analysis of tryptic peptides
Altered protein foldingExpression optimization and folding chaperonesCircular dichroism spectroscopy
Improper complex assemblyCo-expression with partner subunitsNative gel electrophoresis, size exclusion chromatography
Copper center formationSupplementation with copper during expressionAbsorption spectroscopy, EPR analysis

These strategies must be tailored to the specific expression system and research objectives to successfully produce functional recombinant A. gossypii COX2.

How can mass spectrometry be used to verify CUU/CUA codon translation in A. gossypii COX2?

Mass spectrometry provides critical verification of the unique codon translation in A. gossypii mitochondrial proteins:

  • Experimental workflow:

    • Isolate mitochondria from A. gossypii cultures

    • Extract and digest mitochondrial proteins with trypsin

    • Analyze tryptic peptides using LC-MS/MS

    • Search the data against protein databases with different codon translation rules (Leu, Thr, or Ala for CUU/CUA)

  • Case study results:
    In studies of A. gossypii mitochondrial proteins, including Cox2, peptides containing CUA codons were identified exclusively when translated as alanine, not as leucine or threonine. This verification was consistent across multiple experiments and confirmed the bioinformatics predictions .

  • Technical considerations:

    • High-resolution MS instrumentation is necessary to distinguish between similar amino acid masses

    • Multiple peptides containing reassigned codons should be analyzed for confirmation

    • Fragmentation patterns must unambiguously identify the amino acid at relevant positions

This methodology establishes the in vivo translation of CUU/CUA codons in A. gossypii mitochondria, essential knowledge for recombinant expression of its mitochondrial proteins.

What experimental approaches can determine the structure-function relationship of A. gossypii COX2?

Understanding the structure-function relationship of A. gossypii COX2 requires a multi-faceted experimental approach:

  • Structural determination methods:

    • X-ray crystallography of purified protein

    • Cryo-electron microscopy of the intact cytochrome c oxidase complex

    • NMR spectroscopy for dynamic structural elements

    • Molecular modeling based on homologous proteins

  • Functional characterization techniques:

    • Oxygen consumption measurements to assess catalytic activity

    • Stopped-flow spectroscopy to determine electron transfer kinetics

    • Spectroscopic analysis of the copper center

    • Reconstitution into liposomes for proton pumping assays

  • Structure-function correlation approaches:

    • Site-directed mutagenesis targeting alanine residues resulting from CUU/CUA codons

    • Chimeric proteins combining domains from A. gossypii and related organisms

    • Crosslinking studies to identify interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

These complementary approaches can reveal how the unique amino acid composition of A. gossypii COX2 influences its structure, dynamics, and function within the respiratory chain.

How does A. gossypii metabolism support single-cell oil production?

Ashbya gossypii has emerged as a promising organism for single-cell oil (SCO) production with unique metabolic characteristics:

  • Natural lipid profile: A. gossypii naturally accumulates unsaturated fatty acids, with oleic acid constituting more than 50% of the total fatty acid content .

  • Metabolic engineering targets: Studies have identified key modifications that enhance lipid accumulation:

    • Elimination of the beta-oxidation pathway to block fatty acid degradation

    • Introduction of ATP-citrate lyase (ACL) activity to increase cytosolic acetyl-CoA content

  • Remarkable lipid accumulation: Engineered A. gossypii strains lacking the beta-oxidation pathway can accumulate lipids up to 70% of cell dry weight, demonstrating exceptional capacity for oil production .

  • Biotechnological relevance: This lipidogenic capacity positions A. gossypii as a robust tool for producing sustainable oils that can serve as alternatives to petroleum-derived products .

The metabolic versatility of A. gossypii, which enables both riboflavin overproduction and high-level lipid accumulation, makes it a valuable platform organism for various biotechnological applications.

What are the future research prospects for recombinant A. gossypii COX2?

The unique properties of A. gossypii COX2, particularly its altered amino acid composition due to mitochondrial genetic code reassignment, offer several promising research directions:

  • Fundamental studies: Further investigation of how A. gossypii maintains respiratory chain function despite significant amino acid changes in conserved positions can provide insights into protein evolution and adaptability .

  • Biotechnological applications: The unusual codon usage and efficient expression system development in A. gossypii may lead to novel approaches for recombinant protein production .

  • Metabolic engineering: Understanding the relationship between respiratory chain components like COX2 and the production of valuable metabolites such as riboflavin and single-cell oils can inform strategies for strain improvement .

  • Structural biology: Detailed structural analysis of A. gossypii COX2 can reveal adaptations that accommodate alanine residues at positions where other organisms have leucine or threonine .

  • Synthetic biology: The natural codon reassignment in A. gossypii provides a model for engineered genetic code alterations in other organisms.

Research on A. gossypii COX2 sits at the intersection of fundamental molecular biology, evolutionary genetics, and applied biotechnology, offering rich opportunities for both basic science discoveries and practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.