Recombinant Ashbya gossypii Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant COX3 is synthesized in E. coli using codon-optimized DNA constructs. Post-expression, the protein is purified via immobilized metal affinity chromatography (IMAC) leveraging the His tag. Key production parameters include:

  • Purity: >90% as verified by SDS-PAGE ( ).

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C ( ).

  • Reconstitution: Recommended in deionized water with 50% glycerol to prevent aggregation ( ).

Research Applications

Recombinant COX3 is primarily utilized in:

  • Enzyme Activity Assays: To study COX complex kinetics and inhibition profiles.

  • Antibody Production: As an antigen for generating COX3-specific antibodies ( ).

  • Structural Studies: For resolving COX architecture via X-ray crystallography or cryo-EM.

  • Metabolic Engineering: In fungal platforms like A. gossypii to optimize respiratory efficiency for industrial riboflavin production ( ).

Challenges and Considerations

  • Instability: Recombinant COX3 requires glycerol stabilization to maintain solubility ( ).

  • Membrane Integration: Functional studies necessitate reconstitution into lipid bilayers to mimic native mitochondrial conditions.

  • Species-Specific Variations: A. gossypii COX3 may exhibit divergent regulatory features compared to S. cerevisiae or mammalian homologs ( ).

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Our standard shipping method includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%, which you can use as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
COX3; AMI003W; AgCOX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
COX3
Target Protein Sequence
MLYLNRSKFQQFPFHLVTPSPWPIVTSFSLLGLTLTLAFTMHGIIGNIYPLLLSLLVVLL TMTLWFRDIVAETTYLGDHTLAVRKGINLGFTLFVVSEVLIFASLFWAYFHSAMSPDITL GNVWPPVGIEAVQPTELPLLNTIILLASGTTITYSHHGLIEGNRKHALSGLTITFWLIVT FVLCQYIEYSNTSFTITDGIYGSVFFAGTGLHFLHMVMLTIMLGINYWRMRNYHLTSTHH VGYETTTIYLHVLDIIWLALYICFYWWGV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work collaboratively to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the intermembrane space and 4 protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of COX3 in Ashbya gossypii mitochondrial respiration?

Cytochrome c oxidase subunit 3 (COX3) functions as one of the core components of Complex IV in the mitochondrial respiratory chain. Based on studies in related fungi, COX3 represents one of the three mitochondrially encoded core subunits forming a specific assembly module in cytochrome c oxidase construction. This module consists of Cox3p and nuclear-encoded subunits like Cox4p, Cox7p, and Cox13p, which interact to form the complete holoenzyme . The subunit is essential for respiratory function, as evidenced by studies showing that perturbations in cytochrome oxidase assembly lead to respiratory growth defects and dramatically reduced cytochrome oxidase activity .

How can researchers distinguish between assembly intermediates containing COX3 and other cytochrome oxidase components?

Assembly intermediates containing COX3 can be distinguished using a combination of techniques:

  • Epitope tagging: Adding tags (such as HAC or polyhistidine) to Cox3p allows specific isolation of Cox3p-containing complexes

  • Blue native PAGE (BN-PAGE): Separates intact protein complexes based on size

  • Pulse-chase labeling: Tracks newly synthesized Cox3p as it transitions through assembly intermediates

  • Two-dimensional gel electrophoresis: Combines BN-PAGE with SDS-PAGE to identify specific proteins

Studies have identified distinct Cox3p intermediates (C1-C4) with molecular weights ranging from approximately 200-300 kDa, which are separate from Cox1p intermediates (D1-D4) . Analysis of these complexes reveals a precursor-product relationship, with radiolabel shifting from smaller intermediates to the complete COX complex and respiratory chain supercomplexes during a chase period .

What CRISPR/Cas9 approaches are most effective for modifying COX3 in A. gossypii?

For COX3 modification in A. gossypii, a one-vector CRISPR/Cas9 system has proven effective. This system includes three essential components:

  • Cas9 expression module: Contains human codon-optimized Streptococcus pyogenes CAS9 under control of the TEF1 promoter and CYC1 terminator

  • sgRNA expression module: Utilizes A. gossypii SNR52 promoter and terminator sequences

  • Donor DNA (dDNA) module: Provides template for homologous recombination repair

The sgRNA should target a genomic sequence adjacent to a PAM site (5′-NGG-3′) in the COX3 gene. For successful editing, researchers should design a donor DNA containing the desired mutations flanked by homology arms (typically 50-60 bp) matching sequences adjacent to the targeted cut site .

What challenges arise when manipulating mitochondrially-encoded genes like COX3 in A. gossypii?

Manipulating mitochondrially-encoded genes presents several unique challenges:

  • Heterokaryotic transformants: A. gossypii mycelium is organized as multinucleated cells separated by septa, resulting in transformants with both modified and unmodified nuclei. This necessitates sporulation to isolate homokaryotic clones derived from uninucleated spores .

  • Plasmid stability: Episomic plasmids (including CRISPR/Cas9 vectors) are not fully stable in A. gossypii, requiring protocols for plasmid curing after successful editing .

  • Mitochondrial translation regulation: Mitochondrial genes like COX3 are subject to specialized translation regulation systems, as demonstrated in yeast where translational activators create interdependencies between different subunits .

  • Assembly coordination: Modifications to COX3 may disrupt the balanced assembly process of cytochrome oxidase, as seen in studies where overexpression of one component (like Pet111p) can interfere with translation of other components .

How does COX3 participate in the modular assembly pathway of cytochrome c oxidase?

Research supports a modular assembly model for cytochrome c oxidase where COX3 forms a distinct module that interacts with other modules to form the holoenzyme. The process follows these steps:

  • Formation of the Cox3p module: Cox3p associates with nuclear-encoded subunits including Cox4p, Cox7p, Cox13p, and the accessory factor Rcf1p .

  • Development of assembly intermediates: Several Cox3p-containing intermediates (C1-C4) have been identified, representing progressive stages of module assembly .

  • Integration with other modules: The Cox3p module eventually combines with modules containing Cox1p and Cox2p to form the complete cytochrome oxidase complex .

  • Incorporation into supercomplexes: The assembled cytochrome oxidase then associates with the bc1 complex (complex III) to form respiratory supercomplexes .

This modular assembly ensures that the primary interactions between core subunits and their immediate nuclear-encoded partners are established before formation of the complete enzyme core .

What experimental evidence supports the existence of a separate COX3 assembly module?

Several key experimental findings support the existence of a distinct COX3 assembly module:

  • Pulse-chase analysis of tagged Cox3p reveals specific intermediate complexes (C1-C4) that are precursors to the complete cytochrome oxidase .

  • The steady-state concentrations of Cox3p intermediates differ from those of Cox1p and Cox2p intermediates, indicating separate assembly pathways .

  • Two-dimensional gel electrophoresis demonstrates that Cox3p intermediates contain a unique subset of nuclear-encoded subunits compared to Cox1p intermediates .

  • In the final cytochrome oxidase structure, the nuclear-encoded subunits associated with Cox3p in intermediates make direct contact with Cox3p, confirming that these interactions are established early in assembly .

  • Deletion studies of assembly factors reveal module-specific effects, with different factors required for Cox1p, Cox2p, or Cox3p incorporation .

How is the expression of COX3 coordinated with other cytochrome oxidase subunits?

Coordination of COX subunit expression involves sophisticated regulatory mechanisms:

  • Translational regulation: In yeast, mitochondrial mRNAs like COX1 are regulated by specific translational activators (e.g., Mss51 for COX1), creating a negative feedback loop that couples translation to assembly .

  • Assembly-dependent control: The sequestration of translational activators to assembly intermediates renders them incompetent to promote further translation, preventing accumulation of excess unassembled subunits .

  • Cross-talk between subunits: Studies show that overexpression of the COX2 translational activator Pet111p prevents translation of COX1 mRNA, demonstrating interdependence between subunit expression systems .

  • Multi-step regulation: The generation of translational resting states involves not just sequestration but a multi-step process of interactions in a defined order, as seen with Mss51 regulation .

These mechanisms likely operate similarly in A. gossypii, ensuring stoichiometric production of subunits for efficient assembly.

What role do assembly factors play in regulating COX3 expression and incorporation?

Assembly factors perform critical functions in COX3 expression and incorporation:

  • Formation of assembly intermediates: Factors like Coa3 and Cox14 form complexes with newly synthesized core subunits .

  • Translational regulation: These factors are required for the association of translational activators like Mss51 with assembly complexes .

  • Stabilization of unassembled subunits: Without proper assembly factors, accumulated unassembled subunits are rapidly degraded .

  • Coordination of multiple modules: Assembly factors ensure the correct order of interactions between different assembly modules .

In yeast mutants lacking assembly factors like Coa3 or Cox14, cytochrome oxidase activity is drastically reduced despite continued translation of core subunits, highlighting their essential role in functional complex formation .

What methods are most effective for assessing COX3 function in A. gossypii?

Multiple complementary approaches can assess COX3 function:

  • Growth phenotype analysis: Compare growth on fermentable (glucose) versus non-fermentable (glycerol/ethanol) carbon sources to assess respiratory competence .

  • Enzymatic activity measurements: Directly measure cytochrome oxidase activity in isolated mitochondria compared to control enzymes like malate dehydrogenase or complex III .

  • Spectral analysis: Examine cytochrome spectra to detect specific deficiencies in cytochromes a and a3 associated with cytochrome oxidase .

  • Blue native PAGE: Analyze the integrity of respiratory chain supercomplexes, which in yeast typically appear as III2IV and III2IV2 (indicating dimeric complex III associated with one or two cytochrome oxidase monomers) .

  • Immunodetection: Use antibodies against nuclear-encoded subunits like Cox4 and Cox13 to track complex formation .

MethodParameter MeasuredAdvantageControl/Reference
Growth phenotypeRespiratory competenceSimple, physiologically relevantGrowth on fermentable media
Enzyme activityDirect COX activityQuantitative, specificMalate dehydrogenase activity
BN-PAGESupercomplex formationVisualizes intact complexesComplex III (bc1) formation
Spectral analysisCytochrome contentDirect measurement of cofactorsCytochrome c levels

How can researchers troubleshoot issues with cytochrome c oxidase assembly when manipulating COX3?

When troubleshooting cytochrome oxidase assembly issues:

  • Verify mitochondrial localization: Confirm proper localization of Cox3p using techniques like immunofluorescence with mitochondrial markers such as MitoTracker .

  • Analyze assembly intermediates: Use BN-PAGE to identify which specific intermediates accumulate, which can pinpoint where assembly is blocked .

  • Check for degradation: Rapid turnover of unassembled Cox3p often occurs in assembly mutants, which can be assessed through pulse-chase experiments .

  • Examine genetic interactions: Test for interactions with known assembly factors by overexpression or deletion studies .

  • Assess translation: Determine whether the primary defect is in translation or assembly by monitoring incorporation of radiolabeled amino acids into newly synthesized Cox3p .

  • Consider tag interference: If using tagged versions of Cox3p, compare C-terminal versus N-terminal tags, as N-terminal tags have been shown to cause partial functional defects .

What can be learned from applying techniques developed for S. cerevisiae COX3 studies to A. gossypii?

Techniques from S. cerevisiae COX3 studies can provide valuable insights when applied to A. gossypii:

  • Epitope tagging strategies: The HAC and polyhistidine tagging approaches used for yeast Cox3p can be adapted for A. gossypii, with awareness that N-terminal tags may cause more functional disruption than C-terminal tags .

  • Assembly intermediate isolation: The pulse-chase and immunoprecipitation techniques used to identify yeast Cox3p intermediates can reveal whether A. gossypii follows similar assembly pathways .

  • Translation regulation studies: Investigations of translational activators and feedback loops established in yeast can guide searches for similar mechanisms in A. gossypii .

  • Mutant phenotype analysis: The systematic analysis of respiratory growth, enzyme activity, and complex formation used in yeast studies provides a framework for characterizing A. gossypii mutants .

  • CRISPR/Cas9 adaptation: The successful adaptation of CRISPR/Cas9 for A. gossypii provides a powerful tool for targeted modifications to study Cox3p function .

How can studying COX3 in A. gossypii contribute to understanding mitochondrial translation regulation systems?

A. gossypii offers unique advantages for studying mitochondrial translation regulation:

  • Industrial relevance: As a producer of riboflavin and other high-value compounds, A. gossypii represents a different metabolic context for studying respiratory chain regulation .

  • Filamentous growth model: The hyphal growth pattern provides opportunities to study spatial aspects of mitochondrial translation not accessible in unicellular models .

  • Rapid growth adaptation: A. gossypii's ability to achieve high growth rates requires efficient coordination of nuclear and mitochondrial gene expression, potentially revealing new regulatory mechanisms .

  • CRISPR/Cas9 tractability: The availability of marker-free genome engineering enables sophisticated genetic manipulations to dissect translation regulatory networks .

Understanding how A. gossypii coordinates COX3 translation with assembly could reveal conserved and species-specific aspects of mitochondrial gene expression regulation.

What approaches can detect and characterize novel assembly factors for COX3 in A. gossypii?

Identifying novel COX3 assembly factors in A. gossypii could employ these approaches:

  • Affinity purification proteomics: Use tagged Cox3p to isolate associated proteins, followed by mass spectrometry identification, similar to the approach that identified Coa3 in yeast .

  • Genetic screens: Generate and screen respiratory-deficient mutants, focusing on those with normal Cox3p translation but defective assembly .

  • Comparative genomics: Identify A. gossypii homologs of known yeast assembly factors and characterize their functions through targeted deletions .

  • Synthetic genetic arrays: Systematically test genetic interactions between COX3 and other genes to identify functional relationships .

  • Metabolic profiling: Compare metabolic signatures of assembly-deficient strains to identify specific pathways affected by Cox3p assembly defects .

These approaches could reveal unique aspects of cytochrome oxidase assembly in filamentous fungi compared to unicellular yeasts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.