Recombinant Ashbya gossypii Diacylglycerol O-acyltransferase 1 (DGA1)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

DGA1 (UniProt ID: Q75BY0) belongs to the acyl-CoA:diacylglycerol acyltransferase (DGAT) family, which is essential for lipid storage and membrane homeostasis . In Ashbya gossypii, a filamentous fungus industrially exploited for riboflavin production , DGA1 catalyzes the reaction:

DAG + acyl-CoATAG + CoA\text{DAG + acyl-CoA} \rightarrow \text{TAG + CoA}

Recombinant DGA1 is produced in Escherichia coli with an N-terminal His-tag for purification . Its activity influences lipid accumulation and fatty acid (FA) composition, making it a target for metabolic engineering .

Biochemical Properties

Recombinant DGA1 exhibits the following characteristics :

  • Purity: >90% (SDS-PAGE verified).

  • Storage: Lyophilized powder stable at -80°C; reconstituted in Tris/PBS buffer with 50% glycerol.

  • Activity: Requires DAG and acyl-CoA substrates, with specificity for sn-1,2-DAG .

Expression and Stability:

ParameterDetail
HostEscherichia coli
TagN-terminal His-tag
Optimal pH8.0 (Tris/PBS buffer)

Lipid Accumulation in Engineered Strains

Disruption of AgDGA1 in A. gossypii reduces total fatty acid (TFA) accumulation by ~30%, demonstrating its pivotal role in TAG synthesis :

StrainGenotype% TFA/DCW% Linoleic Acid (LA)
Wild-type (A4)Native AgDGA14.91.6
ΔAgDGA1Deletion mutant3.512.0
OverexpressionPGPD-CpFAH125.820.0

Substrate Specificity

DGA1 prefers saturated and monounsaturated acyl-CoA substrates but shows limited activity toward hydroxylated FAs (e.g., ricinoleic acid) . Co-expression with phospholipid:diacylglycerol acyltransferase (LRO1) enhances hydroxylated FA incorporation into TAG .

Applications in Metabolic Engineering

Recombinant DGA1 is leveraged to enhance lipid yields and modify FA profiles in microbial hosts:

  • High-Value Lipid Production:

    • Engineered A. gossypii strains overexpressing AgDGA1 and ∆9-desaturases (AgOLE1/OLE2) achieve 20% LA in TFA, a 15-fold increase over wild-type .

    • Co-expression with CpFAH12 (a hydroxylase) enables ricinoleic acid synthesis, albeit at low yields .

  • Industrial Relevance:

    • Improved TAG accumulation supports biofuel and specialty lipid production .

    • Recombinant DGA1 is used in vitro to study acyltransferase kinetics and inhibitor screening .

Challenges and Future Directions

While recombinant DGA1 is functionally active, key limitations persist:

  • Low Hydroxylated FA Incorporation: Competing pathways and substrate specificity limit ricinoleic acid production .

  • Stability Issues: Long-term storage requires glycerol supplementation to prevent aggregation .

Proposed Solutions:

  • Protein engineering to broaden substrate specificity.

  • Fusion tags or chaperones to enhance solubility .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DGA1; ACR140C; Diacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-461
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
DGA1
Target Protein Sequence
MQDSMDDSLREAEGRQDDSEVSSGTTLGSSTPEDSGVTAKLRKKYQMASALLRRELEELS VYDAKTAGVSGRSSGSGSGGLALLGGRFHVAPLRIPARRRLQTLVVAWHTSSFIYMTVLV LFLAANPLMWWFMVPYMVYYVWNRSPANGGVVRRYSPRLRSLALWRYYCEYYPISLHKSE DLAPTFVPDPRGAEPREWKLRLWLWPTRVELLNLTLQWTRARPQVATGPRYIFGYHPHGV GALGAFGAIATEGCNWSKVFAGIPACLCTLVNQFQIPIYRDYLLGLGCTSVARKNVLKVL EQNYSVCIVVGGAQEALLSRVGSTELVLNKRKGFIKLALETGNVNLVPIYAFGETDCFNV LDTGNESYLRKFQLWIKKTYGFTIPFFFARGVFNYDFGFLPFRNPINVVVGKPVYVDKRR TNPTMEEIDHYHDLYVQELRNVFDKNKHKFGYAGKELKIVE
Uniprot No.

Target Background

Function
This recombinant Ashbya gossypii Diacylglycerol O-acyltransferase 1 (DGA1) catalyzes the terminal and committed step in triacylglycerol (TAG) biosynthesis, utilizing diacylglycerol (DAG) and fatty acyl-CoA as substrates. It is essential for storage lipid synthesis and functions as the primary DAG esterifying enzyme during stationary phase, when TAG production is highly active. DGA1 plays a crucial role in lipid particle synthesis within the endoplasmic reticulum, facilitating localized TAG production at specific ER subdomains.
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Lipid droplet. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Diacylglycerol O-acyltransferase 1 (DGA1) and what is its primary function in Ashbya gossypii?

DGA1 is an enzyme involved in lipid metabolism, specifically in the final step of triacylglycerol (TAG) biosynthesis. In Ashbya gossypii, this enzyme catalyzes the transfer of an acyl group from acyl-CoA to diacylglycerol (DAG) to form TAG, which serves as an energy reserve and a source of fatty acids. The gene is annotated as DGA1 (ACR140C) in the A. gossypii genome and codes for a protein that plays a critical role in lipid storage metabolism .

What expression systems are suitable for producing recombinant Ashbya gossypii DGA1?

The recombinant Ashbya gossypii DGA1 protein has been successfully expressed in E. coli expression systems. According to available data, the full-length protein (amino acids 1-461) can be efficiently produced with an N-terminal His-tag . When designing an expression system for DGA1, researchers should consider:

  • Codon optimization for the host organism

  • Selection of appropriate promoters (T7 promoter systems work well for E. coli)

  • Growth temperature (often lowered to 16-25°C during induction to improve solubility)

  • IPTG concentration for induction (typically 0.1-1.0 mM)

  • Expression duration (4-24 hours depending on protein stability)

What are the optimal purification conditions for His-tagged DGA1?

Purification of His-tagged DGA1 typically follows these steps:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Clarification of lysate by centrifugation at >10,000×g

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Step-wise or gradient elution with increasing imidazole concentrations

  • Buffer exchange to remove imidazole through dialysis or gel filtration

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis .

How should recombinant DGA1 be stored and handled to maintain stability?

For optimal stability, recombinant DGA1 should be handled as follows:

Storage FormConditionsDurationNotes
Lyophilized-20°C/-80°CLong-termStore upon receipt
Reconstituted-20°C/-80°CLong-termAdd 5-50% glycerol, aliquot to avoid freeze-thaw
Working solution4°CUp to one weekAvoid repeated freeze-thaw cycles

The recommended reconstitution protocol involves:

  • Brief centrifugation to bring contents to the bottom of the vial

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 50% for long-term storage

What methods can be used to measure DGA1 enzymatic activity in vitro?

DGA1 activity can be assessed through several approaches:

  • Radioactive assay: Using [14C]-labeled acyl-CoA as substrate and measuring incorporation into TAG

  • Fluorescence-based assay: Using fluorescent DAG analogs and monitoring product formation

  • HPLC or LC-MS analysis: Measuring the conversion of DAG to TAG directly

  • Coupled enzyme assay: Monitoring CoA release using auxiliary enzymes

Each method requires careful optimization of reaction conditions, including:

  • Buffer composition (typically Tris-HCl pH 7.4-8.0)

  • Divalent cation concentration (Mg2+ or Mn2+)

  • Substrate concentrations (both DAG and acyl-CoA)

  • Temperature (usually 25-37°C)

  • Detergent type and concentration for solubilization

How does DGA1 function compare between Ashbya gossypii and other model organisms?

Comparative analysis of DGA1 function reveals important differences between fungal species:

OrganismDGA1 FunctionMetabolic ContextNotable Differences
Ashbya gossypiiTAG synthesisConnected to lipid metabolismPresent and functional
Saccharomyces cerevisiaeTAG synthesisKey for lipid droplet formationSimilar function
Kluyveromyces lactisTAG synthesisDiffers in phospholipid synthesisLacks DGK1 (diacylglycerol kinase) function

These differences suggest species-specific adaptations in lipid metabolism. In K. lactis, the absence of DGK1-coded diacylglycerol kinase (2.7.1.174) indicates potential limitations in utilizing DAG for phospholipid synthesis, which could affect growth when de novo synthesis of fatty acids cannot occur .

What is the relationship between DGA1 function and riboflavin production in Ashbya gossypii?

Ashbya gossypii is industrially important for riboflavin (vitamin B2) production . While direct evidence linking DGA1 to riboflavin biosynthesis is limited, several potential connections exist:

  • Lipid metabolism provides precursors and energy for primary and secondary metabolism

  • TAG turnover may influence metabolic flux during production phases

  • Membrane composition, affected by lipid metabolism enzymes like DGA1, can impact secretion efficiency

  • Carbon source utilization patterns, which involve lipid metabolic pathways, affect riboflavin yields

Understanding these relationships could provide strategies for metabolic engineering to enhance riboflavin production through manipulation of lipid metabolism genes including DGA1.

How is DGA1 expression regulated in response to environmental conditions?

The regulation of DGA1 expression likely responds to:

  • Carbon source availability and quality

  • Nitrogen limitation conditions

  • Growth phase transitions

  • Stress responses (oxidative, osmotic)

The asynchronous nuclear division observed in A. gossypii suggests that gene expression, including that of metabolic enzymes like DGA1, may be spatially regulated within the hyphal cells. This adds an additional layer of complexity to understanding DGA1 regulation in this filamentous fungus.

What approaches can be used to study structure-function relationships in DGA1?

Advanced methodological approaches for DGA1 structure-function studies include:

  • Site-directed mutagenesis: To identify catalytic residues and substrate binding sites

  • Truncation analysis: To define functional domains within the 461-amino acid protein

  • Chimeric enzyme construction: Swapping domains with DGA1 from other species to determine specificity determinants

  • Structural biology approaches: X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Molecular dynamics simulations: To model substrate binding and catalytic mechanism

These approaches can reveal how the unique features of A. gossypii DGA1 contribute to its function and regulation within the lipid metabolic network.

How can genetic engineering of DGA1 be leveraged for biotechnological applications?

Potential genetic engineering strategies include:

  • Overexpression systems: Increasing DGA1 levels to enhance TAG production for biofuels or oleochemicals

  • Promoter engineering: Creating inducible or constitutive expression systems

  • Protein engineering: Modifying substrate specificity to produce designer lipids

  • Integration with other metabolic pathways: Combining with fatty acid biosynthesis modifications for complete pathway engineering

  • Heterologous expression: Introducing DGA1 variants into other production hosts

The expression of heterologous proteins in A. gossypii has been demonstrated with cellulases and β-galactosidase , suggesting DGA1 engineering is feasible.

What are the challenges in studying membrane-associated enzymes like DGA1 and how can they be overcome?

Working with membrane-associated enzymes presents several challenges:

  • Solubilization: Determining optimal detergents for extraction while maintaining activity

  • Reconstitution systems: Developing liposome or nanodisc systems to study function in membrane-like environments

  • Structural integrity: Ensuring the protein maintains its native conformation during purification

  • Activity assays: Designing assays that account for the interfacial nature of the reaction

  • Heterologous expression: Addressing potential toxicity or inclusion body formation

Methodological approaches to overcome these challenges include:

  • Screening multiple detergent types and concentrations

  • Using fusion partners that enhance solubility

  • Employing nanodiscs or liposomes for functional reconstitution

  • Developing in situ activity assays that minimize disruption of native membrane environment

How conserved is DGA1 across fungal species, and what does this reveal about its evolutionary importance?

Genome-wide metabolic re-annotation studies of A. gossypii revealed significant differences in lipid metabolism compared to related fungi . Analyzing DGA1 conservation can provide insights into:

  • Core metabolic functions preserved across evolution

  • Species-specific adaptations in lipid metabolism

  • Potential horizontal gene transfer events

  • Functional divergence after gene duplication events

The high gene homology between A. gossypii and S. cerevisiae (91% of genes are syntenic) provides a valuable comparative framework for understanding DGA1 evolution and function.

What can metabolic network analysis reveal about DGA1's role in different ecological niches?

Comprehensive metabolic analysis comparing A. gossypii with S. cerevisiae (post-whole genome duplication) and K. lactis (pre-whole genome duplication) revealed numerous differences in lipid metabolism pathways . For DGA1 specifically:

  • The differences in lipid metabolism across these related fungi likely reflect adaptations to specific ecological niches

  • The presence or absence of complementary enzymes in the pathway can reveal metabolic strategies

  • Network analysis can identify potential bottlenecks or regulatory points in TAG metabolism

What are the most promising areas for future research on A. gossypii DGA1?

Promising research directions include:

  • Structural studies to reveal the molecular basis of substrate recognition and catalysis

  • Systems biology approaches to understand DGA1's place in the metabolic network

  • Metabolic engineering applications for biofuel or specialty lipid production

  • Comparative studies with DGA1 enzymes from other organisms to understand evolutionary adaptations

  • Investigation of regulatory mechanisms controlling DGA1 expression and activity

These approaches would advance both fundamental understanding and applied biotechnology related to DGA1.

How might new technologies facilitate advanced studies of DGA1 function and regulation?

Emerging technologies that could enhance DGA1 research include:

  • CRISPR/Cas9 genome editing: For precise manipulation of DGA1 and related genes

  • Single-cell analysis: To understand spatial regulation of lipid metabolism in multinucleated hyphae

  • Advanced imaging techniques: For visualizing TAG formation and lipid droplet dynamics

  • Proteomics approaches: To identify interaction partners and post-translational modifications

  • High-throughput enzyme evolution: For developing enhanced DGA1 variants with desired properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.