Recombinant Ashbya gossypii Genetic interactor of prohibitin 7, mitochondrial (GEP7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your preferred tag type for prioritized development.
Synonyms
GEP7; AAR155W; Genetic interactor of prohibitin 7, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
67-234
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
GEP7
Target Protein Sequence
SDTVSKLNSGELTEVVRQRYCVDNKDRCETRMLLTKYPGPAREREMLQVATAELSARDWR KMPRVWQQVSYYHAFGSWGPRTGLSFVGRRPEDFFVTDQKGLWTCSAPRRAEYERSSRAL DPASRAVLYAAALVAAVAALGDLWRRQDADRQVTVAELDLAEPTSSPT
Uniprot No.

Target Background

Function
Involved in respiratory growth and is essential for cell survival in the absence of prohibitins.
Database Links
Protein Families
GEP7 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the genomic classification of GEP7 in Ashbya gossypii?

GEP7 is encoded by the YGL057c open reading frame and belongs to the GEP (Genetic interactors of Prohibitins) gene family. It is classified in the "Unknown" functional group of mitochondrial proteins, indicating its precise molecular function remains to be fully characterized . GEP7 was identified through systematic synthetic genetic array (SGA) analysis with prohibitin-deficient yeast cells, where it demonstrated genetic interaction resulting in growth defects when both genes were mutated .

How is GEP7 localized within Ashbya gossypii cells?

GEP7 is primarily localized to the mitochondria according to proteomic analyses . The specific submitochondrial localization (whether in the inner membrane, outer membrane, intermembrane space, or matrix) has not been definitively established in the available literature, unlike other GEP family members which have been specifically localized. Determining the precise submitochondrial localization would require experimental approaches such as submitochondrial fractionation coupled with immunoblotting or fluorescence microscopy with tagged GEP7 proteins.

What is known about the evolutionary conservation of GEP7 across fungal species?

While the search results don't explicitly discuss GEP7 conservation, they do indicate that several GEP family members belong to highly conserved gene families, such as Gep1 which is related to UPS1/Preli1 genes . Research methodologies to determine GEP7 conservation would include comparative genomic analyses across fungal species, particularly focusing on other industrially relevant filamentous fungi, to identify orthologs and determine sequence conservation patterns.

What are the recommended methods for creating recombinant GEP7 mutants in Ashbya gossypii?

For creating recombinant GEP7 mutants in A. gossypii, researchers should employ PCR-based gene targeting approaches that take advantage of the organism's efficient homologous recombination system. The methodology involves:

  • Design of deletion cassettes containing selectable markers (such as antibiotic resistance genes) flanked by 45-60 bp homology regions to the target locus

  • Transformation of A. gossypii spores using either electroporation or chemical transformation protocols

  • Selection of transformants on appropriate selective media

  • Verification of gene deletion or modification through PCR and/or Southern blotting

  • Phenotypic characterization, particularly focusing on mitochondrial function

A. gossypii has a wide range of molecular tools available for genetic manipulation, making it a valuable biotechnological chassis for metabolic engineering .

How can researchers assess mitochondrial functional changes in GEP7 mutants?

To assess mitochondrial functional changes in GEP7 mutants, researchers should implement a multi-parameter approach:

  • Membrane potential analysis using fluorescent dyes like TMRM or JC-1, similar to the methodology used for prohibitin studies

  • Respiratory chain complex activity assays to determine if oxidative phosphorylation is impaired

  • Mitochondrial morphology assessment using fluorescence microscopy with mitochondria-targeted fluorescent proteins

  • Analysis of mitochondrial phospholipid composition, particularly cardiolipin (CL) and phosphatidylethanolamine (PE), which are critical for prohibitin function

  • Growth rate comparison on fermentable (glucose) versus non-fermentable (glycerol, ethanol) carbon sources to assess respiratory competence

These methodologies would help determine if GEP7 deletion affects mitochondrial integrity similarly to other GEP genes.

What growth media conditions are optimal for studying GEP7 function in Ashbya gossypii?

For studying GEP7 function in A. gossypii, researchers should consider multiple media compositions:

  • Standard rich media (YPD) for optimal growth assessment

  • Minimal defined media to study specific metabolic requirements

  • Media containing different carbon sources:

    • Glucose-based media for fermentative growth

    • Xylose-containing media (such as MX2 media with 0.5% glucose plus 2% xylose) to assess utilization of alternative carbon sources

    • Glycerol-based media to force respiratory growth

  • Industrial waste-based culture media, including:

    • Low-cost oils

    • Glycerol

    • Sucrose (the main carbon source in sugarcane molasses)

A. gossypii can utilize various waste streams as carbon sources, making it valuable for biotechnology applications while also providing different metabolic contexts to study GEP7 function .

How does GEP7 genetically interact with prohibitins in the context of mitochondrial membrane integrity?

GEP7 demonstrates synthetic genetic interaction with prohibitins, resulting in growth defects when both are mutated . This suggests that GEP7 functions in a parallel or compensatory pathway to prohibitins in maintaining mitochondrial membrane integrity.

Based on studies of other GEP proteins, the interaction likely involves one of these mechanisms:

  • Mitochondrial phospholipid homeostasis: Many GEP genes affect levels of cardiolipin (CL) and phosphatidylethanolamine (PE) in mitochondrial membranes

  • Respiratory chain assembly: Several GEP genes are involved in the assembly of respiratory complexes

  • Mitochondrial morphology maintenance: Multiple GEP genes affect mitochondrial dynamics and morphology

Experimental approaches to elucidate this interaction would include comprehensive lipidomic analysis of mitochondrial membranes in single and double mutants, as well as electron microscopy to examine ultrastructural changes in mitochondrial cristae morphology.

What role might GEP7 play in the phospholipid metabolism of mitochondrial membranes?

While the specific role of GEP7 in phospholipid metabolism is not directly addressed in the search results, many GEP proteins have been shown to significantly affect mitochondrial phospholipid composition. Research has demonstrated that loss of several GEP genes leads to strongly reduced levels of PE and/or CL in mitochondrial membranes .

To investigate GEP7's role in phospholipid metabolism, researchers should:

  • Perform lipid profiling by mass spectrometry of wild-type and ΔgepP7 mitochondria

  • Analyze the effects of GEP7 deletion on CL and PE levels

  • Investigate potential interactions between GEP7 and known phospholipid biosynthesis enzymes (e.g., Crd1, Psd1)

  • Assess whether GEP7 affects the localization or activity of lipid transport proteins

The finding that prohibitin-deficient mitochondria contained reduced amounts of CL and slightly increased PE levels suggests a potential connection between prohibitins, GEP proteins, and phospholipid homeostasis .

How does GEP7 compare functionally to other GEP family members in Ashbya gossypii?

To systematically compare GEP7 with other GEP family members, researchers should analyze the following:

GEP Family MemberLocalizationGenetic InteractionKnown/Proposed Function
GEP1Intermembrane space (IMS)Synthetically lethalRegulates mitochondrial phospholipid composition; related to UPS1/Preli1 family
GEP3Mitochondria (M)Growth defectUnknown
GEP4Mitochondria (M)Synthetically lethalUnknown
GEP5Mitochondria (M)Growth defectUnknown
GEP6Mitochondria (M)Synthetically lethalUnknown
GEP7Mitochondria (M)Growth defectUnknown
GEP8Not determined (ND)Synthetically lethalUnknown
GEP9Not determined (ND)Synthetically lethalUnknown

To determine potential functional relationships, experimental approaches should include:

  • Comparative transcriptomic and proteomic analyses of single GEP mutants

  • Creation of double and triple GEP mutants to identify functional redundancy

  • Protein interaction studies to identify shared binding partners

  • Detailed phenotypic characterization focused on mitochondrial parameters

How can recombinant GEP7 be utilized for metabolic engineering in Ashbya gossypii?

Based on the biotechnological applications of A. gossypii described in the search results, recombinant GEP7 could potentially be utilized in metabolic engineering strategies aimed at:

Specific methodological approaches would include:

  • Overexpression of GEP7 in engineered strains designed for production of valuable metabolites

  • Integration of GEP7 modifications into strains engineered for monoterpene production (such as sabinene or limonene)

  • Combining GEP7 manipulation with modifications to lipid metabolism pathways to enhance de novo lipid production

For example, incorporating GEP7 modifications into the metabolic engineering strategy that achieved sabinene production of 684.5 mg/L from mixed formulations of corn-cob lignocellulosic hydrolysates and either sugarcane or beet molasses might further improve yields .

How might GEP7 manipulation affect the production of monoterpenes in engineered Ashbya gossypii strains?

Since mitochondrial function is crucial for cellular metabolism, manipulating GEP7 could potentially affect monoterpene production in engineered A. gossypii strains. Methodological approaches to investigate this would include:

  • Creating GEP7 overexpression and deletion variants in the tNDPS1 genetic background (which overexpresses NPP synthase from Solanum lycopersicum)

  • Comparing monoterpene production (especially sabinene and limonene) in wild-type versus GEP7-modified strains

  • Analyzing the effects on precursor availability, particularly the mevalonate pathway components

  • Monitoring growth characteristics and biomass production over time (similar to the 240-hour growth curves performed for sabinene-producing strains)

The search results indicate that co-overexpression of endogenous HMG1 and ERG12 with heterologous NPP synthase and terpene synthases significantly increased sabinene yields . Determining if GEP7 affects this pathway would be valuable for further optimizing monoterpene production.

What are common challenges in phenotyping GEP7 mutants and how can they be addressed?

Common challenges in phenotyping GEP7 mutants include:

  • Subtle phenotypes: GEP7 mutants may exhibit growth defects only under specific conditions or in combination with other mutations

    • Solution: Test growth under multiple stress conditions (oxidative stress, temperature stress, various carbon sources)

  • Phenotypic overlap with other mitochondrial mutants: Many mitochondrial mutations present similar phenotypes

    • Solution: Use high-resolution techniques like metabolomics and lipidomics to identify specific signatures

  • Variable expression in filamentous fungi: A. gossypii's filamentous nature can lead to heterogeneous gene expression

    • Solution: Use single-cell analysis techniques and quantify phenotypes across multiple hyphae

  • Technical challenges in mitochondrial isolation: Obtaining pure mitochondrial fractions without contamination

    • Solution: Employ gradient centrifugation techniques and verify fraction purity with marker proteins

  • Distinguishing direct from indirect effects: Determining whether phenotypes are directly caused by GEP7 loss

    • Solution: Implement rapid inducible systems for GEP7 depletion to observe immediate effects

Addressing these challenges requires a combination of classical genetic approaches and advanced techniques like time-resolved proteomics and electron microscopy.

How should researchers interpret contradictory data regarding GEP7 function?

When faced with contradictory data regarding GEP7 function, researchers should:

  • Examine strain background differences: Genetic background can significantly affect phenotypes

    • Compare the genetic backgrounds used in contradictory studies

    • Test the mutation in multiple strain backgrounds

  • Consider environmental and experimental conditions: Growth conditions affect mitochondrial function

    • Standardize growth conditions across experiments

    • Test whether contradictions are condition-dependent

  • Evaluate methodological differences:

    • Compare experimental methods in detail

    • Repeat key experiments using multiple methodologies

  • Implement complementary approaches:

    • If biochemical and genetic approaches yield different results, add structural or computational methods

    • Use both in vivo and in vitro approaches to validate findings

  • Consider redundancy and compensation:

    • Investigate whether other GEP family members compensate for GEP7 loss

    • Create double or triple mutants to address functional redundancy

A methodical approach combining these strategies will help resolve contradictions and develop a more accurate understanding of GEP7 function.

What emerging technologies could advance GEP7 research in Ashbya gossypii?

Several emerging technologies could significantly advance GEP7 research:

  • CRISPR-Cas9 genome editing:

    • Enables precise genomic modifications in A. gossypii

    • Allows for multiple simultaneous gene edits

    • Facilitates the creation of conditional mutants through inducible systems

  • Single-cell and spatial transcriptomics:

    • Reveals gene expression heterogeneity across different regions of A. gossypii mycelia

    • Maps GEP7 expression in relation to mitochondrial distribution

  • Cryo-electron tomography:

    • Provides high-resolution 3D images of mitochondrial ultrastructure

    • Helps visualize how GEP7 affects mitochondrial membrane organization

  • Proximity labeling proteomics (BioID, APEX):

    • Identifies proteins in close proximity to GEP7 in vivo

    • Maps the GEP7 interactome within mitochondrial subcompartments

  • Metabolic flux analysis with stable isotopes:

    • Quantifies how GEP7 affects metabolic pathway activities

    • Links mitochondrial structure to metabolic function

These technologies would provide deeper mechanistic insights into GEP7 function and its role in mitochondrial biology within A. gossypii.

What are the key unresolved questions regarding GEP7 function that future research should address?

Future research on GEP7 should address these key unresolved questions:

  • Molecular function: What is the precise biochemical activity of GEP7?

    • Is it an enzyme, structural protein, or regulatory factor?

    • Does it have direct interactions with phospholipids or other mitochondrial components?

  • Relationship to prohibitins: How does GEP7 functionally relate to prohibitin complexes?

    • Does it affect prohibitin complex assembly or stability?

    • Do prohibitins and GEP7 share common interacting partners?

  • Role in phospholipid metabolism: Does GEP7 directly affect phospholipid synthesis or transport?

    • How does it compare to other GEP family members like GEP1 that regulate phospholipid levels?

    • Is its function specific to particular phospholipid species?

  • Connection to mitochondrial dynamics: Does GEP7 influence mitochondrial fusion, fission, or morphology?

    • How does it relate to other mitochondrial morphology genes identified as GEP genes?

  • Biotechnological applications: Can GEP7 manipulation enhance A. gossypii as a biotechnological platform?

    • Would GEP7 overexpression improve monoterpene production or lipid accumulation?

    • Could it enhance growth on alternative carbon sources?

Answering these questions will require integrated genetic, biochemical, and structural approaches, and would significantly advance our understanding of mitochondrial biology and A. gossypii as a biotechnological platform.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.