Recombinant Ashbya gossypii Golgi apparatus membrane protein TVP15 (TVP15)

Shipped with Ice Packs
In Stock

Description

Golgi Function in A. gossypii

Ashbya gossypii’s Golgi apparatus processes high-mannose-type N-glycans (Man₄–Man₁₈GlcNAc₂), critical for protein stability and secretion . During secretion stress (e.g., induced by dithiothreitol), genes involved in vesicle trafficking and vacuolar protein sorting are upregulated, though conventional unfolded protein responses (UPRs) are absent . TVP15 may interact with these pathways, though specific interactions remain uncharacterized.

Research and Applications

TVP15 serves as a tool for studying Golgi dynamics in A. gossypii, which is increasingly engineered for industrial bioproduction (e.g., riboflavin, monoterpenes) . Potential applications include:

  1. Membrane Protein Studies: Investigating transmembrane domain folding and stability.

  2. Secretion Optimization: Elucidating Golgi-mediated bottlenecks in heterologous protein production.

Comparative Analysis of TVP15 Homologs:

OrganismLength (aa)TagExpression HostFunctional Context
Ashbya gossypii143HisE. coliGolgi membrane protein
Schizosaccharomyces pombe132HisE. coliGolgi localization (orthologous)

Gaps and Future Directions

Direct studies on TVP15’s function are absent in the literature. Future research could focus on:

  • Interaction Mapping: Identifying binding partners in the Golgi apparatus.

  • Structural Analysis: Resolving its transmembrane domain structure via cryo-EM.

  • Biotechnological Impact: Engineering TVP15 to enhance secretion efficiency in A. gossypii for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TVP15; AGR106C; Golgi apparatus membrane protein TVP15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TVP15
Target Protein Sequence
MSENDQKGVKFIRALLVTTGAVATLGFLVQLSEVASEFLAAARACFGLPLSVLLVYLEFR PVPLLQQYASFYYSYMGRALLQLLLAVMLLPAGFFQVCAFTMLFMTGFICAALELSSSAP ELPSFRNDGRALSIGAEEDDDMI
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP15 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP15 and what is its cellular localization?

TVP15 is a Golgi apparatus membrane protein originally identified in Ashbya gossypii and Saccharomyces cerevisiae through proteomic analysis of Golgi subcompartments. The protein primarily localizes to Tlg2-containing compartments within the late Golgi/endosomal system . Experimental verification of this localization has been conducted using immunofluorescence double staining techniques with HA-tagged TVP15 proteins and myc-tagged tSNAREs, confirming its predominant presence in these compartments .

To effectively study TVP15 localization, researchers typically employ:

  • Fluorescent protein tagging (GFP, mCherry)

  • Immunofluorescence microscopy

  • Subcellular fractionation followed by Western blotting

How is recombinant TVP15 typically produced for experimental studies?

Recombinant TVP15 production for research purposes commonly employs E. coli expression systems. The standard protocol involves:

  • Cloning the full-length TVP15 gene (1-143aa) into an expression vector with an N-terminal His tag

  • Transforming the construct into E. coli

  • Inducing protein expression under optimized conditions

  • Purifying via affinity chromatography

  • Lyophilization of the purified protein

The resulting recombinant protein typically shows greater than 90% purity as determined by SDS-PAGE analysis . Storage recommendations include maintaining the lyophilized protein at -20°C/-80°C and adding 5-50% glycerol (commonly 50%) after reconstitution to minimize activity loss through freeze-thaw cycles .

What protein-protein interactions has TVP15 been demonstrated to participate in?

TVP15 functions within an interactive network including Yip1-family proteins, particularly Yip4 and Yip5 . This was established through immunoprecipitation studies that revealed TVP15's association with these proteins. The data suggests TVP15, along with related proteins Tvp23 and Tvp18, collectively contributes to the maintenance and function of late Golgi/endosomal compartments .

Interacting PartnerDetection MethodFunctional Significance
Yip4ImmunoprecipitationGolgi/endosomal compartment maintenance
Yip5ImmunoprecipitationGolgi/endosomal compartment maintenance
Tlg2Proteomic analysisDefines compartmental localization

Researchers investigating these interactions typically employ:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid assays

  • Fluorescence resonance energy transfer (FRET)

  • Bimolecular fluorescence complementation (BiFC)

What functional phenotypes are associated with TVP15 disruption?

While TVP15 is nonessential for growth under standard laboratory conditions, genetic analysis has revealed interesting interactions that suggest its functional importance . Notably, disruption of tvp15 shows synthetic aggravation when combined with ypt6 or ric1 null mutations . This genetic interaction suggests TVP15 functions in parallel or compensatory pathways with these genes.

Despite these genetic interactions, biochemical analyses indicate that processing of carboxypeptidase Y and alkaline phosphatase in tvp15 disruptants occurs normally, suggesting redundancy in the system or a more specialized function for TVP15 .

Methodological approaches to study TVP15 disruption include:

  • Gene deletion through homologous recombination

  • CRISPR-Cas9 mediated knockout

  • Synthetic genetic array analysis

  • Phenotypic screening under various stress conditions

How can researchers effectively tag TVP15 for in vivo studies?

Tagging TVP15 for in vivo visualization and interaction studies requires careful consideration of the protein's membrane topology. Successful approaches have been documented in related proteins and can be applied to TVP15 research.

A proven methodology involves:

  • Generating a PCR product containing a fluorescent protein tag (e.g., GFP) and selection marker (e.g., GEN3 cassette)

  • Designing primers with homology to the 3' end of TVP15 (immediately upstream and several nucleotides downstream of the stop codon)

  • Co-transforming the PCR product with a plasmid containing the TVP15 gene

  • Selecting transformants on appropriate media (e.g., containing G418)

  • Verifying the recombinant construct by diagnostic enzymatic digestion and sequencing

  • Transforming the verified construct into the target organism

This approach has been successfully employed for tagging similar proteins like Whi5 in A. gossypii, as documented in research examining nuclear division cycles .

What is the relationship between A. gossypii TVP15 and its homologs in S. cerevisiae?

A. gossypii and S. cerevisiae diverged from a common ancestor, yet both maintain TVP15 as part of their cellular machinery. While A. gossypii is filamentous and S. cerevisiae is unicellular, their Golgi apparatus organization shows conservation of key proteins including TVP15 .

Unlike some other genes such as CDC11, which underwent duplication in A. gossypii resulting in two paralogs (CDC11a and CDC11b) , TVP15 appears to have maintained a single copy. This evolutionary conservation suggests a fundamental role in Golgi function that has remained consistent despite morphological divergence between these fungi.

Comparative genomic and proteomic analyses between these species can reveal:

  • Functional constraints on protein evolution

  • Adaptation to different cellular morphologies

  • Conservation of core trafficking machinery

What experimental considerations are important when working with recombinant TVP15?

Researchers working with recombinant TVP15 should consider several critical factors to ensure experimental success:

  • Storage and stability: The lyophilized protein should be stored at -20°C/-80°C. Working aliquots may be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Reconstitution protocol: Optimal reconstitution involves:

    • Brief centrifugation of the vial prior to opening

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of glycerol (5-50% final concentration) for long-term storage

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been established as an effective storage buffer for maintaining protein stability .

  • Expression system selection: While E. coli has been validated for TVP15 expression, alternative systems may be considered for specific experimental needs, particularly when post-translational modifications are of interest.

How can researchers investigate TVP15's role in membrane trafficking pathways?

To elucidate TVP15's role in membrane trafficking, researchers typically employ:

  • Vesicle trafficking assays: Using fluorescently labeled cargo proteins to track movement through the Golgi and endosomal compartments in wild-type versus tvp15 mutant cells.

  • Electron microscopy: Examining ultrastructural changes in Golgi morphology and vesicle distribution in the presence or absence of functional TVP15.

  • Synthetic genetic interactions: Systematic analysis of genetic interactions between TVP15 and known trafficking components like YPT6 and RIC1, which have shown synthetic aggravation when combined with tvp15 disruption .

  • Proteomics of isolated compartments: Following the approach documented by Inadome et al., researchers can immunoisolate Golgi subcompartments to identify additional TVP15-associated proteins .

What approaches can identify functional domains within TVP15?

Understanding the functional domains of TVP15 requires systematic structure-function analysis:

  • Truncation and mutation analysis: Creating a series of truncated or point-mutated variants to identify regions critical for localization, interactions, or function.

  • Topology mapping: Using protease protection assays or fluorescent reporter fusions to determine membrane orientation and accessibility of domains.

  • Chimeric protein analysis: Swapping domains between TVP15 and related proteins (e.g., Tvp23, Tvp18) to identify shared versus unique functional regions.

  • Conservation analysis: Comparing sequences across species to identify highly conserved motifs likely to be functionally important.

How might TVP15 contribute to developmental regulation in A. gossypii?

A. gossypii shows intriguing developmental regulation of gene expression, as evidenced by studies of other genes like CDC11 . Investigation of TVP15's potential developmental regulation could include:

  • Transcript profiling throughout the A. gossypii life cycle (spore, germination, hyphal growth)

  • Reporter gene constructs to visualize TVP15 expression patterns

  • Conditional mutants to assess stage-specific requirements

  • Comparative analysis with S. cerevisiae homologs to identify divergent regulation

Such studies could reveal whether TVP15, like CDC11b, shows developmental stage-specific expression patterns that reflect specialized functions in filamentous growth .

What are the implications of TVP15's interactions with Yip proteins for Golgi structure?

The interaction network between TVP15 and Yip1-family proteins (Yip4, Yip5) suggests a coordinated role in maintaining Golgi/endosomal compartment integrity . Future research directions may include:

  • Structural studies of the TVP15-Yip protein complexes

  • Dynamic imaging of these interactions during vesicle formation and trafficking

  • Reconstitution of minimal membrane systems with purified components

  • Lipidomic analysis of TVP15-containing membranes to identify potential lipid interactions

These approaches could illuminate how TVP15 contributes to the specialized membrane environments characteristic of different Golgi subcompartments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.