Recombinant Ashbya gossypii Golgi apparatus membrane protein TVP18 (TVP18)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Processes

TVP18 belongs to the TVP protein family (Tvp38, Tvp23, Tvp15, Tvp18) identified in Saccharomyces cerevisiae Golgi/endosomal compartments . Key functional insights include:

Functional AspectDescription
LocalizationPredominantly associated with Tlg2-containing Golgi/endosomal membranes
InteractionsForms complexes with Yip1-family proteins (Yip4, Yip5) to maintain membrane integrity
Genetic InteractionsDisruption of tvp15 and tvp23 exacerbates defects in ypt6 (Rab GTPase) or ric1 mutants

While nonessential under standard conditions, TVP18 may assist in membrane trafficking or organelle maintenance. Its conserved sequences in higher eukaryotes suggest broader biological relevance .

Production in Ashbya gossypii

Though TVP18 is currently expressed in E. coli , Ashbya gossypii has emerged as a promising host for recombinant protein production due to:

  • High-yield secretion: Achieves up to 37-fold higher extracellular activity for heterologous proteins compared to Saccharomyces cerevisiae .

  • Glycosylation: Recombinant proteins retain native glycosylation patterns, critical for bioactivity .

Current Recombinant TVP18 Applications

ApplicationDetails
Structural StudiesHis-tagged TVP18 enables purification for X-ray crystallography or NMR
ELISA AssaysUsed as an antigen in immunoassays to study anti-TVP18 antibodies
Membrane Trafficking ResearchModels Golgi/endosomal dynamics in eukaryotic systems

Optimizing Secretion in Ashbya gossypii

While A. gossypii shows promise, challenges include:

  • Promoter efficiency: Native promoters (e.g., AgTEF) outperform heterologous ones (e.g., ScADH1) but require optimization .

  • Secretion stress: Transcriptomic studies reveal limited unfolded protein response activation, suggesting bottlenecks in ER/Golgi capacity .

Expanding Functional Insights

  • Homology studies: Comparative analysis with mammalian TVP homologs could reveal conserved trafficking mechanisms .

  • Protein engineering: Truncation or mutagenesis may enhance solubility or secretion in A. gossypii .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
TVP18; AGL072W; Golgi apparatus membrane protein TVP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TVP18
Target Protein Sequence
MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP18 and where is it localized in cells?

TVP18 is a membrane protein that localizes primarily in the Golgi apparatus. It was initially identified through proteomic analysis of immunoisolated Golgi subcompartments of Saccharomyces cerevisiae. Immunofluorescence double staining studies using HA-tagged Tvp proteins and myc-tagged tSNAREs have confirmed that TVP18 mainly localizes in Tlg2-containing compartments of the Golgi apparatus . TVP18 is one of four previously uncharacterized proteins (along with Tvp38, Tvp23, and Tvp15) discovered in this context. The full-length protein consists of 167 amino acids and contains conserved sequences that can also be found in higher eukaryotes .

How should recombinant TVP18 be properly stored and reconstituted for experiments?

For optimal storage and reconstitution of recombinant TVP18:

Storage:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What is the function of TVP18 in cellular processes?

Based on available research, TVP18 appears to be part of an interactive network with other Tvp proteins (Tvp23 and Tvp15) and the Yip1-family proteins . While the exact function remains under investigation, several observations are significant:

  • TVP18 is nonessential for growth under laboratory conditions, as demonstrated by knockout studies

  • It primarily localizes in Tlg2-containing compartments of the Golgi apparatus

  • The protein contains conserved sequences found in higher eukaryotes, suggesting evolutionary importance

  • Its membrane localization and interactive network with other proteins suggest a potential role in vesicular trafficking or Golgi structure maintenance

Further research is needed to fully elucidate the specific functional roles of TVP18 in cellular processes.

What are the recommended approaches for studying TVP18 localization in cellular systems?

When investigating TVP18 localization, consider the following methodological approaches:

Immunofluorescence microscopy protocol:

  • Express epitope-tagged TVP18 (HA-tag has been successfully used) in your cell system

  • Co-express known Golgi markers (e.g., myc-tagged tSNAREs) for colocalization studies

  • Fix cells using 4% paraformaldehyde (15 minutes at room temperature)

  • Permeabilize with 0.1% Triton X-100

  • Block with 3% BSA in PBS

  • Perform double staining with anti-HA and anti-myc antibodies

  • Visualize using fluorophore-conjugated secondary antibodies

  • Analyze colocalization using confocal microscopy

For live-cell imaging, consider GFP-tagging strategies, though validation against fixed-cell immunofluorescence is recommended to ensure tag doesn't disrupt localization.

How can researchers effectively design experiments to investigate TVP18 protein-protein interactions?

To investigate TVP18 protein-protein interactions, consider these methodological approaches:

Immunoprecipitation (IP) strategy:

  • Express epitope-tagged TVP18 in your experimental system

  • Prepare cell lysates under non-denaturing conditions (use mild detergents like 1% NP-40 or 0.5% Triton X-100)

  • Perform IP using antibodies against the epitope tag

  • Analyze co-precipitated proteins by:

    • Western blotting (for known interactors)

    • Mass spectrometry (for unbiased discovery of novel interactors)

Proximity labeling approaches:

  • Generate BioID or TurboID fusions with TVP18

  • Express in cells and supply biotin

  • Isolate biotinylated proteins using streptavidin pull-down

  • Identify interactors using mass spectrometry

Based on previous research, focus on interactions with other Tvp proteins (Tvp23, Tvp15) and Yip1-family proteins, as these have been shown to form an interactive network with TVP18 .

What control measures should be implemented when studying recombinant TVP18 function in vitro?

When designing experiments to study recombinant TVP18 function in vitro, implement these essential controls:

Protein quality controls:

  • Verify protein purity by SDS-PAGE (>90% purity should be confirmed)

  • Validate protein identity by Western blot or mass spectrometry

  • Assess proper folding using circular dichroism spectroscopy

  • Check for aggregation using dynamic light scattering

Experimental controls:

  • Include a heat-denatured TVP18 sample as a negative control

  • Use buffer-only conditions to establish baseline measurements

  • When studying membrane interactions, include control membrane proteins with known properties

  • For protein-protein interaction studies, include non-specific binding controls (e.g., irrelevant His-tagged protein)

Replication strategy:

  • Perform experiments with at least three independent protein preparations

  • Include technical replicates within each experiment

  • Vary experimental conditions systematically to ensure robustness of observations

Following these control measures will help ensure that observed effects are specifically attributable to TVP18 function rather than experimental artifacts.

How can researchers effectively design knockout or knockdown studies to investigate TVP18 function?

For designing effective knockout or knockdown studies of TVP18:

CRISPR-Cas9 knockout approach:

  • Design guide RNAs targeting exonic regions of TVP18, prioritizing early exons

    • Use at least 3 different guide RNA designs to control for off-target effects

    • For A. gossypii, optimize codon usage in the Cas9 expression construct

  • Include appropriate controls:

    • Wild-type cells (no CRISPR)

    • Cells expressing Cas9 without guide RNA

    • Cells with CRISPR targeting a non-essential gene with known phenotype

  • Verify knockout by:

    • PCR and sequencing of the targeted locus

    • Western blot confirmation of protein absence

    • RT-qPCR to confirm absence of transcript

RNA interference approach (for knockdown):

  • Design at least 3 independent siRNA or shRNA constructs targeting different regions of TVP18 mRNA

  • Include scrambled sequence controls with similar GC content

  • Optimize transfection conditions for your specific cell type

  • Verify knockdown efficiency by Western blot and RT-qPCR (aim for >80% reduction)

  • Establish dose-response and time-course of knockdown

Phenotypic analysis:
Given that TVP18 is nonessential for growth under laboratory conditions , focus on stress conditions or specialized cellular processes:

  • Membrane trafficking assays

  • Golgi morphology analysis

  • Protein secretion efficiency

  • Response to membrane stress (e.g., tunicamycin treatment)

  • Interactions with known binding partners (Tvp23, Tvp15, and Yip1-family proteins)

What approaches can be used to study the evolutionary conservation of TVP18 across species?

To investigate the evolutionary conservation of TVP18 across species, implement these research approaches:

Computational phylogenetic analysis:

  • Collect TVP18 homolog sequences from diverse species using BLAST searches

  • Perform multiple sequence alignment using MUSCLE or CLUSTAL

  • Generate phylogenetic trees using maximum likelihood methods

  • Calculate conservation scores for each amino acid position

  • Identify highly conserved motifs or domains

Structure-function analysis across homologs:

  • Predict secondary structures using tools like PSIPRED

  • Map conserved regions onto predicted structural models

  • Design chimeric proteins swapping domains between distant homologs

  • Express and test functionality of chimeric proteins

Cross-species complementation studies:

  • Create TVP18 knockout in model organisms (yeast, mammalian cells)

  • Complement with TVP18 homologs from different species

  • Assess restoration of function using appropriate assays

  • Determine which regions are necessary for conserved functions

This multi-faceted approach can reveal the evolutionary trajectory of TVP18 and identify functionally critical regions that have been maintained across phylogenetic distance.

What are the methodological considerations for reconstituting TVP18 into artificial membrane systems?

When reconstituting TVP18 into artificial membrane systems, consider these methodological approaches:

Liposome reconstitution protocol:

  • Select appropriate lipid composition:

    • Consider using Golgi-mimetic lipid mixtures (phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, and cholesterol)

    • Test multiple compositions to determine optimal conditions

  • Solubilize purified TVP18 in mild detergent (e.g., 0.5% DDM or 1% OG)

  • Mix with lipids at protein:lipid ratios ranging from 1:100 to 1:1000

  • Remove detergent by:

    • Dialysis against detergent-free buffer

    • Biobeads absorption

    • Gel filtration

  • Verify successful reconstitution by:

    • Negative stain electron microscopy

    • Dynamic light scattering

    • Flotation assays

Nanodiscs or other nanoscale membrane mimetics:

  • Prepare MSP (membrane scaffold protein) according to established protocols

  • Mix TVP18, lipids, and MSP at optimized ratios

  • Remove detergent to form nanodiscs

  • Purify reconstituted nanodiscs by size exclusion chromatography

Functional validation:

  • Assess protein orientation using protease protection assays

  • Probe membrane integrity using fluorescent dyes

  • Measure protein activity or interactions in the reconstituted system

These approaches provide controlled systems to study TVP18 membrane interactions and potential functional activities in isolation from the cellular environment.

What are common challenges in expressing and purifying recombinant TVP18, and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant TVP18:

Expression challenges and solutions:

ChallengePotential Solution
Low expression levels1. Optimize codon usage for expression host
2. Test different promoter systems
3. Use fusion partners (MBP, SUMO) to enhance solubility
4. Optimize induction conditions (temperature, IPTG concentration)
Protein aggregation1. Lower induction temperature (16-20°C)
2. Reduce expression time
3. Add solubilizing agents (glycerol, mild detergents) to lysis buffer
4. Consider refolding from inclusion bodies
Proteolytic degradation1. Add protease inhibitors to all buffers
2. Express in protease-deficient strains
3. Optimize purification speed to minimize degradation time

Purification challenges and solutions:

ChallengePotential Solution
Poor His-tag accessibility1. Move tag to opposite terminus
2. Introduce a flexible linker between tag and protein
3. Use denaturing conditions followed by refolding
Co-purification of contaminants1. Increase imidazole in wash buffers (30-50 mM)
2. Add secondary purification step (ion exchange, size exclusion)
3. Use TagZyme for His-tag removal followed by reverse IMAC
Detergent selection issues1. Screen detergent panel (DDM, OG, LDAO, FC-12)
2. Test detergent concentration series
3. Consider detergent exchange during purification

Reconstitution challenges:

  • For aggregation during reconstitution, try slow dilution methods

  • If activity is lost, verify protein orientation in membranes

  • For heterogeneous preparations, improve quality control through additional purification steps

How can advanced imaging techniques be applied to study TVP18 distribution and dynamics in the Golgi apparatus?

Advanced imaging techniques offer powerful approaches to study TVP18 dynamics:

Super-resolution microscopy approaches:

  • STED (Stimulated Emission Depletion) microscopy:

    • Offers 30-80 nm resolution to resolve Golgi subcompartments

    • Use bright, photostable dyes (e.g., Atto647N, Abberior Star dyes)

    • Consider dual-color STED to visualize TVP18 with interacting partners

  • PALM/STORM (Single molecule localization microscopy):

    • Achieves 10-30 nm resolution through single-molecule localization

    • Requires photoconvertible fluorophores (mEos, Dendra2) or photoswitchable dyes

    • Enables quantitative analysis of protein clustering and organization

Live-cell imaging strategies:

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Tag TVP18 with GFP or other fluorescent protein

    • Photobleach a region of interest and monitor fluorescence recovery

    • Calculate diffusion coefficients and mobile/immobile fractions

  • Optogenetic approaches:

    • Fuse TVP18 to light-sensitive domains (CRY2, iLID)

    • Use light to induce clustering or activation

    • Monitor effects on Golgi structure and function

  • Split fluorescent protein complementation:

    • Fuse fragments of fluorescent proteins to TVP18 and potential interactors

    • Interaction brings fragments together, restoring fluorescence

    • Enables visualization of interactions in specific Golgi subdomains

These techniques can reveal how TVP18 distributes within Golgi subdomains and how its localization may change in response to cellular conditions or perturbations.

What is the current understanding of TVP18's role in the interactive network with Yip1-family proteins, and how can researchers extend this knowledge?

The current understanding of TVP18's interaction with Yip1-family proteins includes:

  • Immunoprecipitation studies have shown that TVP18, along with Tvp23 and Tvp15, participates in an interactive network with Yip1-family proteins

  • These interactions suggest a potential role in membrane trafficking or Golgi structure maintenance

  • The functional significance of these interactions remains incompletely characterized

To extend this knowledge, researchers should consider:

Experimental approaches to characterize interactions:

  • Quantitative interaction analysis:

    • Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Determine binding affinities between TVP18 and Yip1-family proteins

    • Map interaction domains through truncation mutants

  • Structural studies:

    • Utilize Cryo-EM to visualize complexes

    • Perform cross-linking mass spectrometry to identify interaction interfaces

    • Use hydrogen-deuterium exchange mass spectrometry to map binding regions

Functional analysis of the interaction network:

  • Generate separation-of-function mutations that specifically disrupt TVP18-Yip1 interactions

  • Assess effects on:

    • Golgi morphology and function

    • Membrane trafficking pathways

    • Protein localization and stability

  • Perform synthetic genetic array analysis to identify genetic interactions between TVP18 and Yip1-family genes

Systems-level analysis:

  • Integrate proteomic, genetic, and cell biological data to build network models

  • Identify conditional dependencies of the interactions under different cellular stresses

  • Perform comparative studies across species to determine evolutionary conservation of the interaction network

These approaches would significantly advance our understanding of TVP18's role within this protein interaction network and its broader cellular functions.

What emerging technologies could be applied to better understand the structure-function relationship of TVP18?

Several emerging technologies hold promise for advancing structure-function studies of TVP18:

AlphaFold2 and structure prediction:

  • Generate computational models of TVP18 structure using AlphaFold2

  • Validate key structural features using experimental approaches

  • Use predicted structures to design targeted mutations for functional testing

  • Apply molecular dynamics simulations to explore conformational dynamics

Cryo-electron microscopy approaches:

  • Single-particle analysis for high-resolution structure determination

  • Cryo-electron tomography to visualize TVP18 in its native cellular context

  • In situ structural studies using focused ion beam milling and tomography

  • Correlative light and electron microscopy to connect function with structure

Mass spectrometry innovations:

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Cross-linking mass spectrometry to identify interaction interfaces

  • Native mass spectrometry to determine oligomeric states

  • Protein footprinting to identify exposed regions

Integrative structural biology:
Combine multiple experimental approaches (X-ray crystallography, NMR, SAXS, crosslinking MS) with computational modeling to generate comprehensive structural models

These technologies would provide unprecedented insights into TVP18's structural organization and how it relates to function in the Golgi apparatus.

How might TVP18 function differ across different cell types or under various stress conditions?

Understanding contextual variations in TVP18 function represents an important research frontier:

Cell type-specific studies:

  • Compare TVP18 expression, localization, and interactome across:

    • Different tissues (secretory vs. non-secretory)

    • Normal vs. cancer cell lines

    • Specialized cell types with expanded Golgi (e.g., neurons, professional secretory cells)

  • Use single-cell approaches to detect heterogeneity within populations

Stress response analysis:

  • Systematically study TVP18 under various cellular stresses:

Stress ConditionAnalysis MethodExpected Impact
ER stress (tunicamycin, DTT)Localization, interaction analysisMay alter TVP18 distribution or interactions
Golgi fragmentation (nocodazole)Live imaging, biochemical fractionationCould reveal role in Golgi structural maintenance
Membrane lipid perturbationsLipidomics, membrane fluidity assaysMight affect TVP18 membrane integration
Secretory pathway overloadCargo trafficking assaysCould uncover role in trafficking adaptation
Nutrient limitationExpression analysis, phosphoproteomicsMay reveal regulatory modifications

Experimental approaches:

  • CRISPR activation/interference to modulate TVP18 levels under stress

  • Proximity labeling to capture stress-specific interactors

  • Phosphoproteomics to identify stress-responsive modifications

  • Live-cell reporters to monitor dynamics during stress response and recovery

These investigations would reveal how TVP18 function is modulated according to cellular context and environmental conditions.

What are the potential implications of TVP18 research for understanding human disease mechanisms related to membrane trafficking?

Research on TVP18 has potential implications for understanding several human diseases:

Neurodegenerative diseases:

  • Many neurodegenerative conditions involve disrupted membrane trafficking

  • Study TVP18 homologs in neuronal models of Alzheimer's, Parkinson's, and ALS

  • Investigate whether disease-associated mutations affect TVP18 interaction networks

  • Determine if TVP18 function is altered in patient-derived cellular models

Cancer biology:

  • Altered Golgi structure and function is a hallmark of many cancers

  • Compare TVP18 expression and localization in normal vs. cancer tissues

  • Investigate whether TVP18 contributes to cancer-associated changes in glycosylation or secretion

  • Determine if targeting TVP18 or its interactions could modify cancer cell behavior

Rare genetic disorders:

  • Identify whether mutations in human TVP18 homologs are associated with congenital disorders

  • Create cellular or animal models with corresponding mutations

  • Characterize molecular and cellular consequences of these mutations

  • Develop potential therapeutic approaches based on mechanistic understanding

Metabolic disorders:

  • Investigate TVP18's potential role in regulating membrane lipid composition

  • Study interactions with lipid transport proteins and their disease relevance

  • Determine if TVP18 function is altered in models of metabolic syndrome or diabetes

By connecting fundamental knowledge about TVP18 function to human disease contexts, researchers can potentially identify new therapeutic targets or diagnostic markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.