Recombinant Ashbya gossypii Golgi apparatus membrane protein TVP38 (TVP38)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Recombinant TVP38 is typically produced in E. coli for research applications, with purification involving Tris-based buffers and glycerol stabilization . Key production parameters include:

ParameterDetails
Host OrganismE. coli
TagNot explicitly stated; may include His-tag (common in similar systems)
Purity>90% (SDS-PAGE for Kluyveromyces lactis TVP38 analogs; assumed similar)
Storage-20°C/-80°C; repeated freeze-thaw cycles discouraged

While A. gossypii itself is a promising host for recombinant protein production , TVP38 has not been reported as a target for heterologous expression in this organism. Native promoters like AgTEF or AgGPD could theoretically enhance TVP38 secretion, but optimization strategies remain underexplored .

Cell Division and Membrane Dynamics

TVP38 is associated with Golgi-mediated membrane trafficking, a process critical for fungal morphogenesis. In A. gossypii, Bud3-dependent localization of TVP38 ensures proper actin ring contraction and septal chitin deposition. Mislocalization of TVP38 in Δbud3 mutants results in delocalized septa and defective cell division .

N-Glycosylation and Protein Quality Control

A. gossypii produces high-mannose N-glycans (Man₄–Man₁₈GlcNAc₂), which may influence TVP38’s stability or trafficking. Under secretion stress (e.g., induced by dithiothreitol), A. gossypii upregulates genes involved in protein folding and ER-associated degradation, though TVP38-specific responses remain uncharacterized .

Industrial and Research Relevance

  • Biochemical Assays: Recombinant TVP38 is used in ELISA kits for studying Golgi function or fungal membrane biology .

  • Structural Studies: The protein’s transmembrane domains make it a candidate for studying fungal membrane organization.

  • Comparative Genomics: Sequence alignment with S. cerevisiae homologs could reveal conserved mechanisms of septation .

Research Gaps and Future Directions

  1. Functional Studies: Direct evidence linking TVP38 to Golgi function or membrane trafficking in A. gossypii is limited.

  2. Post-Translational Modifications: Whether TVP38 undergoes N-glycosylation or phosphorylation remains unexplored .

  3. Host Engineering: Leveraging A. gossypii’s native promoters (AgTEF) or secretion pathways to improve TVP38 yield .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
TVP38; ADR226C; Golgi apparatus membrane protein TVP38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TVP38
Target Protein Sequence
MADHYEARTSSQGALNVDRRTSISNENFFDIEEEDFLDMYPLSARQRLIYQCKRSSRKLL NTFMDLPLWKRAAVLLLCGGATVSALVMMVFHKSILERMIKISNELRSWWYTPFIFFLLI FFVSFPPLIGFSMLCTSAGLVYGVSFKGWLIISLGTVLGSIAAFSVFKTVFRSYAERLIR LNDKFEALASILQDHNSYWIIALLRLCPFPYSLTNGAIAGVYGISIRNFSIAQVLTTPKL FMYLFIGSRLKNLGESSSTATKLFDILSILFAIIALTATASILYYKTKERYLELQRRNQD RFDTLNF
Uniprot No.

Target Background

Function
Recombinant *Ashbya gossypii* Golgi apparatus membrane protein TVP38 is a Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP38 and what is its role in Ashbya gossypii?

TVP38 is a membrane protein localized in the Golgi apparatus of Ashbya gossypii. Based on proteomic analyses of similar proteins in Saccharomyces cerevisiae, TVP38 is part of a family of previously uncharacterized proteins (alongside Tvp23, Tvp18, and Tvp15) found in Tlg2-containing membranes . While TVP38 has been identified in the Golgi apparatus, its precise function remains under investigation. Current evidence suggests it may participate in membrane trafficking and Golgi compartment maintenance. Similar to its yeast counterpart, A. gossypii TVP38 is likely nonessential for growth under standard laboratory conditions but may play important roles in specific cellular processes or stress conditions .

Methodological approach: To investigate TVP38's role, researchers should consider combining genetic knockout studies with comparative proteomic analyses of wild-type and TVP38-deficient strains. Fluorescence microscopy using GFP-tagged TVP38 can help visualize its cellular distribution and dynamics.

How can TVP38 be expressed and purified for in vitro studies?

Recombinant TVP38 can be expressed in multiple systems including yeast, E. coli, baculovirus, and mammalian cells . For Ashbya gossypii TVP38, expression systems should be selected based on research requirements:

Expression SystemAdvantagesChallengesRecommended for
E. coliHigh yield, cost-effective, rapidPotential issues with proper folding and post-translational modificationsInitial structural studies, antibody production
YeastSimilar cellular environment, proper foldingModerate yieldFunctional studies requiring native-like protein
BaculovirusHigher eukaryotic PTMs, good yieldMore complex, time-consumingStudies requiring complex folding and modifications
Mammalian cellsMost native-like protein structureLower yield, costlyInteraction studies requiring fully authentic protein

For purification, researchers typically employ affinity chromatography using tags such as His-tag or Avi-tag (for biotinylated versions) . The recombinant protein is typically supplied as a lyophilized powder and should be reconstituted in sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What localization patterns does TVP38 show in the Golgi apparatus?

Based on immunofluorescence studies of the related TVP38 in Saccharomyces cerevisiae, this protein predominantly localizes to Tlg2-containing compartments within the Golgi network . In A. gossypii, researchers should expect a similar distribution pattern, primarily in the trans-Golgi network (TGN) and endosomal compartments.

Methodological approach: For precise localization studies, implement:

  • Immunofluorescence with double staining using anti-TVP38 antibodies and established Golgi markers

  • Live-cell imaging with fluorescently tagged TVP38

  • Immuno-electron microscopy for ultrastructural localization

  • Subcellular fractionation followed by Western blot analysis

Temporal dynamics of TVP38 localization throughout the cell cycle can be monitored using synchronized cultures and time-lapse microscopy.

How conserved is TVP38 across fungal species?

TVP38 contains conserved sequences found in numerous eukaryotes, including fungi and higher organisms . Comparative sequence analysis reveals several conserved domains that likely play crucial roles in protein function and localization.

SpeciesSequence Identity to A. gossypii TVP38Key Conserved DomainsNotable Differences
S. cerevisiae~70-80% (estimated)Transmembrane domain, C-terminal regionMinor variations in N-terminal region
Other filamentous fungi~50-70% (estimated)Transmembrane domainSpecies-specific insertions
Higher eukaryotes~30-45% (estimated)Core functional domainAdditional regulatory regions

Methodological approach: For conservation analysis, employ multiple sequence alignment tools (CLUSTAL, MUSCLE), followed by phylogenetic tree construction to visualize evolutionary relationships. Identify functionally critical residues through site-directed mutagenesis of conserved regions.

What antibodies and detection methods are available for TVP38?

For detection of Ashbya gossypii TVP38, researchers can employ several approaches:

  • Commercial antibodies against recombinant TVP38 protein

  • Detection of tagged versions (His-tag, Avi-tag biotinylated)

  • Custom antibody production using synthetic peptides from unique TVP38 regions

Detection methods include:

  • Western blotting (sensitivity ~0.1-1 ng protein)

  • Immunofluorescence microscopy

  • Flow cytometry for quantitative analysis

  • ELISA for quantification in complex samples

For optimal results, validate antibodies using both positive controls (recombinant protein) and negative controls (TVP38 knockout strains).

How does TVP38 interact with other proteins in the Golgi membrane network?

Evidence from S. cerevisiae suggests that TVP proteins participate in an interactive network with Yip1-family proteins, specifically Yip4 and Yip5 . These interactions appear important for maintaining the integrity and function of late Golgi/endosomal compartments.

Methodological approaches for investigating TVP38 interactions:

  • Proximity-dependent biotin identification (BioID): Fuse TVP38 with a promiscuous biotin ligase to identify proximal proteins in its native environment

  • Co-immunoprecipitation coupled with mass spectrometry: Isolate TVP38 complexes from A. gossypii lysates and identify interacting partners

  • Two-hybrid screening: Identify potential interactors in a high-throughput manner

  • Fluorescence resonance energy transfer (FRET): Confirm direct interactions in live cells

Preliminary data from S. cerevisiae suggests that disruption of TVP-family proteins in combination with mutations in ypt6 or ric1 genes leads to synthetic growth defects, indicating functional relationships with these trafficking regulators .

What structural features characterize TVP38 and how do they relate to function?

TVP38 contains an N-terminal hydrophobic region that likely functions as a transmembrane domain, anchoring the protein to the Golgi membrane. While complete structural characterization of A. gossypii TVP38 is not yet available, structural predictions and functional analyses suggest:

DomainResidue PositionPredicted StructureHypothesized Function
N-terminal~1-30Transmembrane helixMembrane anchoring
Central region~31-150Mixed α/β foldProtein-protein interactions
C-terminal~151-220Predominantly α-helicalRegulatory functions

Methodological approaches for structural characterization:

  • X-ray crystallography: Requires purification of stable, crystallization-quality protein

  • Cryo-electron microscopy: Particularly useful for membrane proteins in their native lipid environment

  • NMR spectroscopy: For analyzing structural dynamics in solution

  • Cross-linking mass spectrometry: To identify interacting regions within protein complexes

For functional validation of structural features, systematic mutagenesis of key domains followed by cellular localization and interaction studies is recommended.

How does TVP38 contribute to membrane trafficking in Ashbya gossypii?

While direct evidence for TVP38's role in A. gossypii membrane trafficking is limited, studies in S. cerevisiae suggest TVP-family proteins collaborate with Yip proteins to maintain late Golgi/endosomal compartments . This suggests TVP38 may contribute to:

  • Vesicle formation or budding from the trans-Golgi network

  • Cargo selection or sorting

  • Membrane fusion and/or fission events

  • Maintenance of Golgi structure and function

Methodological approaches:

  • Live-cell trafficking assays: Track fluorescently labeled cargo proteins in wild-type vs. TVP38-deficient cells

  • Electron microscopy: Analyze ultrastructural changes in Golgi morphology in TVP38 mutants

  • Cargo processing analysis: Measure rates of protein modification and transport through the secretory pathway

  • Liposome reconstitution assays: Test TVP38's direct role in membrane dynamics in vitro

What techniques can be used to study TVP38 post-translational modifications?

Post-translational modifications (PTMs) often regulate membrane protein function and localization. For TVP38, potential modifications include:

ModificationDetection MethodFunctional Significance
PhosphorylationPhospho-specific antibodies, Mass spectrometryRegulation of protein interactions or trafficking
GlycosylationGlycosidase treatment, Lectin blottingProtein stability and folding
PalmitoylationClick chemistry, Mass spectrometryMembrane association and microdomain targeting
UbiquitinationUbiquitin-specific antibodies, Mass spectrometryProtein turnover and quality control

Methodological approaches:

  • Mass spectrometry-based proteomics: For comprehensive PTM mapping

    • Enrichment strategies for specific modifications (e.g., TiO₂ for phosphopeptides)

    • Quantitative approaches to compare PTM changes under different conditions

  • Site-directed mutagenesis: Mutate potential modification sites and assess functional consequences

  • In vitro modification assays: Identify enzymes responsible for adding/removing modifications

  • Inhibitor studies: Use PTM-specific inhibitors to assess functional importance

How can CRISPR/Cas9 be used to study TVP38 function in Ashbya gossypii?

CRISPR/Cas9 technology offers powerful approaches for functional genomics studies of TVP38:

  • Gene knockout: Complete deletion of TVP38 to assess loss-of-function phenotypes

  • Domain-specific mutations: Targeted modifications of functional domains

  • Endogenous tagging: Addition of fluorescent or affinity tags to the native locus

  • Conditional expression systems: Creation of inducible or repressible TVP38 variants

Recommended experimental design for CRISPR/Cas9 editing in A. gossypii:

ApplicationgRNA Design ConsiderationsRepair TemplateValidation Methods
Complete knockoutTarget early exons, avoid off-targetsNone (NHEJ) or donor with selection markerPCR, sequencing, Western blot
Point mutationsTarget specific domain, PAM proximityssODN with mutations and silent PAM mutationsRFLP analysis, sequencing
Protein taggingTarget C-terminus (typically)Donor with tag sequence and homology armsFluorescence, Western blot
Promoter replacementTarget region upstream of start codonDonor with inducible promoter and selection markerRT-qPCR, Western blot

For phenotypic analysis of TVP38 mutants, examine:

  • Growth characteristics under various conditions

  • Golgi morphology and membrane trafficking efficiency

  • Protein secretion and sorting

  • Cell wall integrity and stress responses

  • Protein-protein interactions with known Golgi components

How does TVP38 function compare between Ashbya gossypii and Saccharomyces cerevisiae?

Comparative analysis between A. gossypii and S. cerevisiae TVP38 provides insights into conserved functions and species-specific adaptations:

S. cerevisiae TVP38 has been characterized as part of a group of proteins (including Tvp23, Tvp18, and Tvp15) that localize to Tlg2-containing compartments and interact with Yip-family proteins . In A. gossypii, which has a filamentous growth pattern compared to the unicellular S. cerevisiae, TVP38 likely maintains core functions while potentially acquiring adaptations related to the extended hyphal growth pattern.

Methodological approach for comparative studies:

  • Complementation experiments testing whether A. gossypii TVP38 can rescue S. cerevisiae tvp38 deletion phenotypes

  • Chimeric protein analysis swapping domains between the two orthologs

  • Comparative interactome studies identifying species-specific binding partners

  • Co-expression network analysis to identify differences in functional associations

What roles might TVP38 play in industrial applications of Ashbya gossypii?

A. gossypii has emerging importance as a biotechnology platform organism, especially for the production of monoterpenes like sabinene from agro-industrial wastes . Understanding TVP38's role in the secretory pathway could have implications for:

  • Optimization of recombinant protein secretion

  • Enhancement of metabolite export pathways

  • Improving stress tolerance during industrial fermentation

  • Engineering membrane dynamics for increased productivity

For researchers working with A. gossypii as a biotechnology platform, investigating TVP38's impact on secretory capacity could provide valuable insights for strain optimization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.