Recombinant Ashbya gossypii Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
GET1; AFR006C; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
GET1
Target Protein Sequence
MDYWILLVLAFLVADKSWHLTGLLATKLTSPERLQQLIRERQELHQQQQSLSAQDHYAKW TKNNRRLDVLDRDIARVRKNYLESVEATKARLAKLKLLVVTVPFTALKFYKGKLPVYALP KGMFPRFIEGTLEHGWLYMALAPLNMKQFSEGASVAVSLGIWLFALLRVLGAIEFVLETL REQNPQVATETAKVHARTAQAASAN
Uniprot No.

Target Background

Function

Function: Recombinant Ashbya gossypii Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins possessing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii GET1 and what is its biological function?

Ashbya gossypii GET1 (Golgi to ER traffic protein 1) is a 205-amino acid membrane protein that functions in the retrograde protein trafficking pathway from the Golgi apparatus to the endoplasmic reticulum (ER). It is also known as "Guided entry of tail-anchored proteins 1" and plays a crucial role in the insertion of tail-anchored proteins into the ER membrane . The protein has a UniProt ID of Q754R6 and contains several transmembrane domains that anchor it within the ER membrane .

GET1 performs its function as part of a multiprotein complex that recognizes and facilitates the post-translational insertion of tail-anchored proteins, which are characterized by having a single C-terminal transmembrane domain. This mechanism is particularly important for ensuring proper cellular localization of many essential proteins involved in vesicular trafficking, protein translocation, and membrane dynamics.

How does A. gossypii differ from other model organisms for recombinant protein studies?

Ashbya gossypii offers several distinct advantages as a model organism for recombinant protein studies compared to traditional systems:

  • It is a filamentous fungus with a multinucleated hyphal structure that divides asynchronously, offering unique cellular organization for protein expression studies

  • It demonstrates remarkable genomic similarities with Saccharomyces cerevisiae, facilitating the transfer of accumulated knowledge from this well-studied model organism

  • It possesses high genetic tractability with a rich molecular toolbox available for its manipulation

  • It has inherent capacity for post-translational modifications required for bioactivity and stability of recombinant proteins

  • It secretes low amounts and variety of native proteins with negligible extracellular protease activity, which simplifies downstream processing and recovery of secreted products

  • It can grow in inexpensive waste-derived substrates to high cell densities, making it economically attractive

  • It has demonstrated suitability for use in large-scale industrial fermentation processes, particularly for riboflavin production

These characteristics make A. gossypii particularly valuable for researchers interested in studying ER-Golgi trafficking proteins like GET1 in a system that combines the advantages of both unicellular yeasts and filamentous fungi.

What expression systems can be used to produce recombinant A. gossypii GET1?

Recombinant A. gossypii GET1 can be expressed in multiple systems, each with distinct characteristics:

E. coli expression system:

  • The search results indicate successful expression of full-length A. gossypii GET1 protein (1-205aa) with an N-terminal His-tag in E. coli

  • Advantages include rapid growth, high protein yields, and well-established protocols

  • Limitations include potential lack of post-translational modifications and possible incorrect folding of eukaryotic membrane proteins

Homologous expression in A. gossypii:

  • A. gossypii can be used for homologous expression of its own GET1 protein, which may be advantageous for functional studies

  • Strong promoters such as AgTEF and AgGPD from A. gossypii have been shown to improve recombinant protein expression by up to 8-fold compared to heterologous promoters like ScPGK1

  • Using glycerol instead of glucose as carbon source can increase recombinant protein production by approximately 1.5-fold

Alternative eukaryotic systems:

  • S. cerevisiae could serve as an alternative expression system due to its genomic similarities with A. gossypii

  • Other filamentous fungi like Trichoderma reesei might be considered for high-level secretion

What are the optimal conditions for purifying recombinant A. gossypii GET1?

Based on the available information for the commercially produced recombinant A. gossypii GET1 , the following purification guidance can be provided:

Starting material:

  • Express GET1 with an N-terminal His-tag in E. coli

  • Full-length protein (1-205aa) with sequence: MDYWILLVLAFLVADKSWHLTGLLATKLTSPERLQQLIRERQELHQQQQSLSAQDHYAKWTKNNRRLDVLDRDIARVRKNYLESVEATKARLAKLKLLVVTVPFTALKFYKGKLPVYALPKGMFPRFIEGTLEHGWLYMALAPLNMKQFSEGASVAVSLGIWLFALLRVLGAIEFVLETLREQNPQVATETAKVHARTAQAASAN

Purification protocol:

  • Harvest E. coli cells expressing His-tagged GET1

  • Lyse cells using appropriate buffer systems

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Achieve >90% purity as determined by SDS-PAGE

  • Store in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

Reconstitution guidelines:

  • Briefly centrifuge vial before opening

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

How can researchers assess the functional activity of recombinant GET1 protein?

To assess the functional activity of recombinant A. gossypii GET1, researchers can employ several complementary approaches:

Protein trafficking assays:

  • Express fluorescently tagged tail-anchored proteins in A. gossypii cells

  • Compare their localization in wild-type versus GET1 knockout or GET1-overexpressing strains

  • Quantify mislocalization rates and patterns using confocal microscopy

Reconstitution experiments:

  • Purify recombinant GET1 and reconstitute in liposomes

  • Assess its ability to facilitate insertion of tail-anchored proteins in vitro

  • Measure insertion efficiency using protease protection assays or fluorescence-based techniques

Complementation studies:

  • Express A. gossypii GET1 in S. cerevisiae get1Δ mutants

  • Evaluate rescue of growth defects and protein trafficking abnormalities

  • Compare with positive controls (S. cerevisiae GET1) and negative controls (empty vector)

Protein-protein interaction studies:

  • Use co-immunoprecipitation with tagged GET1 to identify interaction partners

  • Confirm interactions using techniques like bimolecular fluorescence complementation

  • Map interaction domains through truncation or mutation analysis

What methods can be used to study GET1 localization in A. gossypii cells?

Studying GET1 localization in A. gossypii requires specialized approaches due to its filamentous, multinucleated nature:

Fluorescent protein tagging:

  • Generate GET1-GFP or GET1-mCherry fusion constructs under native or controlled promoters

  • Transform A. gossypii using established protocols

  • Visualize localization using confocal microscopy

  • Co-localize with established ER markers to confirm proper localization

Immunofluorescence microscopy:

  • Fix A. gossypii hyphae using formaldehyde or other appropriate fixatives

  • Permeabilize cell walls using enzymatic digestion (e.g., zymolyase treatment)

  • Incubate with anti-GET1 primary antibodies and fluorescently labeled secondary antibodies

  • Co-stain with markers for different organelles (ER, Golgi, nuclei)

  • Image using high-resolution microscopy

Subcellular fractionation:

  • Homogenize A. gossypii mycelia under conditions that preserve organelle integrity

  • Separate organelles via differential centrifugation

  • Perform western blotting on fractions using anti-GET1 antibodies

  • Compare GET1 distribution with established organelle markers

How can gene editing techniques be optimized for modifying GET1 expression in A. gossypii?

A. gossypii is amenable to various gene editing techniques, which can be optimized for modifying GET1 expression:

Homologous recombination-based approaches:

  • Design targeting cassettes with homology regions flanking the GET1 gene

  • Include selectable markers (e.g., drug resistance genes) for transformant selection

  • Transform A. gossypii spores or protoplasts using established protocols

  • Confirm integration at the correct locus using PCR and sequencing

Promoter replacement strategies:

  • Replace the native GET1 promoter with controllable promoters:

    • Strong constitutive promoters (AgTEF, AgGPD) for overexpression

    • Inducible promoters for controlled expression

  • The AgTEF and AgGPD promoters have shown up to 8-fold improvement in recombinant protein expression compared to heterologous promoters

CRISPR-Cas9 system adaptation:

  • Optimize codon usage of Cas9 for expression in A. gossypii

  • Design guide RNAs targeting GET1 sequences

  • Deliver CRISPR components using established transformation methods

  • Screen transformants for desired modifications

Expression level verification:

  • Quantify GET1 transcript levels using RT-qPCR

  • Assess protein levels via western blotting with anti-GET1 or anti-tag antibodies

  • Compare expression under different promoters and growth conditions

How does GET1 function relate to protein secretion stress in A. gossypii?

The relationship between GET1 function and protein secretion stress in A. gossypii can be investigated through several approaches:

Transcriptomic analysis:

  • Compare gene expression profiles between wild-type A. gossypii and GET1-modified strains

  • Analyze under normal conditions and during induced secretion stress

  • Focus on unfolded protein response (UPR) genes and ER-associated degradation (ERAD) machinery

  • Previous studies have shown that protein secretion stress in A. gossypii correlates with transcriptional changes related to translation down-regulation and ion/amino acid transmembrane transport up-regulation

Secretion stress induction:

  • Express heterologous proteins known to induce secretion stress, such as T. reesei endoglucanase I (EGI)

  • Monitor stress markers in cells with normal versus altered GET1 levels

  • Assess impacts on growth, morphology, and heterologous protein yields

Protein trafficking dynamics:

  • Study the kinetics of protein movement through the secretory pathway

  • Utilize fluorescently tagged reporter proteins with different trafficking signals

  • Compare trafficking efficiency in wild-type versus GET1-modified strains

What are common challenges in working with recombinant A. gossypii GET1 and how can they be addressed?

Researchers working with recombinant A. gossypii GET1 may encounter several challenges:

Protein solubility issues:

  • Challenge: GET1 is a membrane protein with multiple transmembrane domains, potentially leading to solubility problems

  • Solutions:

    • Use mild detergents during extraction and purification (e.g., DDM, LDAO)

    • Express as fusion with solubility-enhancing tags (e.g., MBP, SUMO)

    • Optimize buffer conditions (pH, salt concentration, additives)

Expression level optimization:

  • Challenge: Low expression levels of heterologous proteins in A. gossypii

  • Solutions:

    • Replace heterologous promoters with native A. gossypii promoters like AgTEF and AgGPD (up to 8-fold improvement)

    • Use glycerol instead of glucose as carbon source (1.5-fold improvement)

    • Remove terminator sequences that might interfere with expression (e.g., ScADH1 terminator)

    • Consider random mutagenesis approaches that have shown 2-fold improvement in some recombinant protein expression

Functional verification:

  • Challenge: Confirming that recombinant GET1 retains native activity

  • Solutions:

    • Perform complementation tests in get1Δ mutants

    • Develop in vitro activity assays for purified protein

    • Use appropriate controls to benchmark activity levels

How can researchers assess the impact of GET1 modifications on A. gossypii growth and morphology?

Assessing the impact of GET1 modifications requires comprehensive phenotypic analysis:

Growth analysis:

  • Measure growth rates on solid and liquid media under various conditions

  • Monitor biomass accumulation using dry weight measurements

  • Compare growth on different carbon sources (glucose, glycerol, waste-derived substrates)

  • Assess tolerance to various stressors (temperature, pH, osmotic pressure)

Morphological assessment:

  • Examine hyphal morphology using phase contrast and differential interference contrast microscopy

  • Quantify parameters such as:

    • Hyphal diameter and length

    • Branching frequency and patterns

    • Septal formation and spacing

  • Compare with wild-type controls under identical conditions

Nuclear dynamics analysis:

  • Stain nuclei using DNA-specific dyes or express fluorescently tagged nuclear proteins

  • Assess nuclear density and distribution patterns

  • In wild-type A. gossypii, mitoses are most frequent near cortical septin rings at growing tips and branchpoints

  • Determine if GET1 modifications affect the spatial pattern of nuclear division

Protein secretion profiling:

  • Analyze the secretome using proteomics approaches

  • Quantify total secreted protein levels

  • Assess the impact on secretion of heterologous proteins

  • A. gossypii naturally secretes low amounts of native proteins with negligible extracellular protease activity

How does GET1 function interact with stress response pathways in A. gossypii?

The interaction between GET1 function and stress response pathways in A. gossypii can be examined through:

Nutrient starvation response:

  • A. gossypii responds to nutrient starvation by activating stress responses

  • In starving cells, CDK tyrosine phosphorylation increases in an AgSwe1p-dependent manner, resulting in diminished nuclear density

  • Investigate whether GET1 alterations affect this starvation response pathway

  • Compare nuclear division patterns and CDK phosphorylation levels in wild-type versus GET1-modified strains under starvation conditions

Unfolded protein response (UPR):

  • Induce ER stress using agents like tunicamycin or DTT

  • Monitor UPR activation through reporters or transcript analysis of UPR target genes

  • Compare UPR activation kinetics and magnitude between wild-type and GET1-modified strains

  • Assess whether GET1 overexpression or deletion affects cellular tolerance to ER stress

Protein quality control pathways:

  • Examine activation of ER-associated degradation (ERAD) machinery

  • Measure ubiquitination levels of ERAD substrates

  • Assess proteasome activity and localization

  • Determine if GET1 modifications alter the cell's capacity to eliminate misfolded proteins

What role might GET1 play in recombinant protein production optimization in A. gossypii?

GET1's potential role in optimizing recombinant protein production can be investigated through:

Engineering enhanced secretion capacity:

  • Modify GET1 expression levels to potentially enhance protein trafficking

  • Test hypothesis that optimized GET1 levels may improve proper localization of secretory pathway components

  • Measure impact on heterologous protein yields and quality

Correlation with secretion performance:

  • Compare GET1 expression levels across different A. gossypii strains with varying secretion capacities

  • Analyze whether natural variations in GET1 sequence or expression correlate with secretion efficiency

  • Develop predictive models for strain improvement based on GET1 status

Co-expression strategies:

  • Test co-expression of GET1 with other secretory pathway components

  • Determine optimal ratios of different trafficking factors

  • Assess impact on yields of various recombinant proteins with different characteristics

Integration with cultivation strategies:

  • A. gossypii can grow in cheap waste-derived substrates to high cell densities

  • Investigate how different cultivation conditions affect GET1 expression and function

  • Optimize media composition and feeding strategies to enhance GET1-dependent protein trafficking

What emerging technologies could advance the study of A. gossypii GET1?

Several emerging technologies hold promise for advancing A. gossypii GET1 research:

Cryo-electron microscopy:

  • Determine high-resolution structure of A. gossypii GET1 alone and in complex with interaction partners

  • Compare with structures from other organisms to identify conserved and divergent features

  • Guide rational protein engineering approaches

Single-cell analysis techniques:

  • Develop methods to assess GET1 expression and localization in individual nuclei within multinucleated A. gossypii hyphae

  • Combine with spatial transcriptomics to map gene expression patterns in relation to GET1 activity

  • Investigate potential heterogeneity in GET1 function across different hyphal regions

Synthetic biology approaches:

  • Design and test synthetic GET pathways with optimized components

  • Create orthogonal trafficking systems for specific recombinant proteins

  • Develop tunable GET1 expression systems responsive to specific stimuli

Genome-scale metabolic modeling:

  • Incorporate GET1 and protein trafficking constraints into existing A. gossypii metabolic models

  • Predict optimal genetic modifications for enhanced recombinant protein production

  • A genome-scale metabolic model for A. gossypii is now available, enabling comprehensive metabolic engineering strategies

How might comparative studies across fungal species inform our understanding of GET1 function?

Comparative studies can provide valuable insights into GET1 function:

Evolutionary analysis:

  • Compare GET1 sequences across fungal species with different morphologies (unicellular vs. filamentous)

  • Identify conserved domains and species-specific adaptations

  • Reconstruct the evolutionary history of the GET pathway in fungi

Functional complementation:

  • Express GET1 orthologs from different fungi in A. gossypii get1Δ mutants

  • Assess rescue efficiency and identify species-specific functional differences

  • Create chimeric proteins to map functional domains

Systems-level comparison:

  • Compare protein trafficking networks across fungal species

  • Identify differences in GET pathway organization and regulation

  • Relate to differences in cellular morphology, growth habits, and protein secretion capacity

Cross-species protein production:

  • Test heterologous protein production in various fungal hosts with modified GET pathways

  • Identify species-specific optimization strategies

  • Develop predictive frameworks for selecting optimal expression systems based on target protein characteristics

Table 1: Comparison of Expression Systems for Recombinant A. gossypii GET1

Expression SystemAdvantagesLimitationsOptimal ApplicationsKey Optimization Strategies
E. coli- Rapid growth
- High protein yields
- Well-established protocols
- Demonstrated success
- Lack of eukaryotic PTMs
- Potential folding issues with membrane proteins
- Structural studies
- Antibody production
- In vitro assays
- Optimize codon usage
- Use solubility-enhancing tags
- Express in membrane-protein optimized strains
A. gossypii (homologous)- Native processing environment
- Proper folding likely
- Possible for functional studies
- Slower growth than bacteria
- Potentially lower yields
- Functional studies
- Localization studies
- Protein-protein interactions
- Use AgTEF or AgGPD promoters (8-fold improvement)
- Use glycerol as carbon source (1.5-fold improvement)
S. cerevisiae- Well-characterized genetics
- Genomic similarity to A. gossypii
- Unicellular growth
- May lack A. gossypii-specific factors- Comparative studies
- Complementation tests
- Optimize for yeast codon usage
- Use strong yeast promoters
Mammalian cells- Advanced eukaryotic PTMs
- Complex membrane environment
- Expensive
- Slow growth
- Complex media requirements
- Studies requiring mammalian-like modifications- Stable cell line development- Optimize transfection protocols

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.