Recombinant Ashbya gossypii J domain-containing protein 1 (JID1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ashbya gossypii JID1

Recombinant Ashbya gossypii J domain-containing protein 1 (JID1) is a bioengineered protein derived from the filamentous hemiascomycete Ashbya gossypii. It belongs to the J-protein family, characterized by the presence of a conserved J domain that regulates the activity of 70-kDa heat-shock proteins (Hsp70). JID1 is expressed in Escherichia coli with an N-terminal His-tag for purification and structural studies .

Amino Acid Sequence Highlights

RegionSequence ExcerptFunctional Significance
J DomainMAKRANWSLDGQQSSGGGAASWICACTDKISIAKALTRSLSVMLSRPTALLRTGARWRVS LTASGRSTVRCASTVAGWQGGLSWPQGKQPTPYEVLGLVKTGVDARQLKKRYHELAKLYH PDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMYATGWAHGPAPMAPAMAHG AYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWALCMLAGFQVMAFLIRLEERTSK SAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFRSWGLYRTKAELDEAARTNEALVRQ LEGGKCritical for Hsp70 interaction and ATPase regulation .
C-Terminal RegionLEGGKPotential substrate-binding or regulatory domain .

Applications in Biotechnology

  • Protein Folding Studies: Use in in vitro assays to study J-domain-mediated Hsp70 regulation.

  • Recombinant Protein Production: Evaluate JID1’s role in enhancing secretion yields in A. gossypii or heterologous hosts (e.g., Pichia pastoris) .

  • Stress Response Modeling: Investigate JID1’s interaction with unfolded proteins during secretion stress, as A. gossypii lacks a conventional unfolded protein response (UPR) .

Comparative Analysis with Yeast J-Proteins

FeatureA. gossypii JID1S. cerevisiae Homologs (e.g., Ydj1)
Domain StructureJ domain + C-terminal extensionJ domain + zinc-finger + C-terminal domain (type I)
Subcellular LocalizationUnknownCytosol (Ydj1), mitochondria (Mdj1), ER (Scj1)
FunctionHypothetical (folding, stress)ATPase stimulation, substrate binding, prion management

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
JID1; ADL327W; J domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
JID1
Target Protein Sequence
MAKRANWSLDGQQSSGGGAASWICACTDKISIAKALTRSLSVMLSRPTALLRTGARWRVS LTASGRSTVRCASTVAGWQGGLSWPQGKQPTPYEVLGLVKTGVDARQLKKRYHELAKLYH PDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMYATGWAHGPAPMAPAMAHG AYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWALCMLAGFQVMAFLIRLEERTSK SAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFRSWGLYRTKAELDEAARTNEALVRQ LEGGK
Uniprot No.

Target Background

Function
Probable chaperone.
Database Links
Protein Families
DnaJ family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is Ashbya gossypii J domain-containing protein 1 (JID1) and what are its key characteristics?

Ashbya gossypii J domain-containing protein 1 (JID1), also known as ADL327Wp, is a protein with a J domain that belongs to the molecular chaperone family. It is encoded by the JID1 gene (also referred to as ADL327W or AGOS_ADL327W) in the filamentous fungus Ashbya gossypii . J domain-containing proteins typically function as co-chaperones that regulate the activity of Hsp70 chaperones, mediating protein folding, translocation, and degradation processes.

The J domain is characterized by a highly conserved tripeptide of histidine, proline, and aspartic acid (HPD motif) that is essential for stimulating the ATPase activity of Hsp70 chaperones. By analogy with other fungal J-domain proteins such as Ydj1 in Saccharomyces cerevisiae, JID1 likely plays important roles in protein quality control and cellular stress responses in A. gossypii .

What are the optimal expression systems for producing recombinant JID1?

Recombinant JID1 can be expressed in various host systems, with E. coli being the most commonly used for initial characterization studies. Based on commercial protein information, recombinant A. gossypii JID1 can be produced in E. coli, yeast, baculovirus, or mammalian cell expression systems . The choice of expression system depends on research requirements:

  • E. coli expression: Provides high yields and is cost-effective, but may lack post-translational modifications present in the native protein.

  • Yeast expression: Offers a eukaryotic environment that may better preserve protein function, particularly relevant since A. gossypii is a fungus.

  • Baculovirus/mammalian expression: Provides more complex eukaryotic processing capabilities.

For functional studies of JID1, yeast expression systems might be most appropriate given that A. gossypii is phylogenetically related to S. cerevisiae and other yeasts.

What are the recommended storage conditions for maintaining JID1 activity?

Recombinant JID1 should be stored in liquid form containing glycerol at -20°C for regular use or -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles. Repeated freezing and thawing should be avoided as it can lead to protein degradation and loss of activity .

For experimental work, researchers should consider buffer conditions that maintain protein stability, typically including:

  • pH buffer (often HEPES or phosphate-based, pH 7.0-7.5)

  • Salt (typically 100-150 mM NaCl)

  • Reducing agent (DTT or β-mercaptoethanol)

  • Glycerol (10-20%)

How does JID1 compare structurally and functionally to other J-domain proteins?

JID1 belongs to the J-domain protein family, which is highly conserved across species. When comparing JID1 to the well-characterized Ydj1 from S. cerevisiae, several structural and functional insights emerge:

Ydj1 is a class A J-domain protein characterized by:

  • An N-terminal J domain essential for interaction with Hsp70 proteins

  • Zinc-binding domains (ZBDI and ZBDII) that coordinate one zinc ion each

  • A characteristic Cys-X-X-Cys-X-Gly-X-Gly motif repeated four times to form the zinc-binding domains

Structural analysis of Ydj1 shows specific Cys residues in each zinc-binding domain: Cys143 and Cys201 in ZBDI and Cys162 and Cys185 in ZBDII . These form a tertiary structure containing both α-helices and β-sheets, confirmed by circular dichroism studies showing a minimum at ~208 nm (characteristic of α-helical domains) and significant signal between 210-220 nm (characteristic of β-sheet domains) .

By analogy, JID1 likely shares these structural features, though specific differences would require direct structural comparisons. The J-domain structure is crucial for the protein's function as it mediates interactions with Hsp70 chaperones.

What experimental approaches can be used to study zinc binding in JID1?

If JID1 contains zinc-binding domains similar to other J-domain proteins, researchers can employ several methodologies to investigate zinc's role in its structure and function:

What is the role of JID1 in Ashbya gossypii multinucleated hyphae?

A. gossypii forms multinucleated hyphae with distinctive nuclear dynamics. While the specific role of JID1 in these processes isn't directly addressed in the search results, research on A. gossypii nuclear dynamics provides context for potential JID1 functions:

A. gossypii exhibits extensive bidirectional movements and bypassing of nuclei, with dynein serving as the motor for these movements . The cytoplasmic microtubule (cMT) cytoskeleton emanates from each nucleus and contributes to nuclear positioning through sliding along the cortex .

As a J-domain protein, JID1 may participate in:

  • Protein quality control during nuclear division and movement

  • Stress response during hyphal growth

  • Assistance in folding and assembly of cytoskeletal components involved in nuclear dynamics

  • Interaction with dynein or dynein-associated proteins

Further research using JID1 knockout or tagged strains would be necessary to determine its specific role in these processes.

How does JID1 contribute to the biotechnological potential of Ashbya gossypii?

A. gossypii has established biotechnological importance, particularly for riboflavin production, and has more recently been explored for:

  • Recombinant protein production

  • Single cell oil (SCO) production

  • Flavor compound synthesis

  • Inosine production

The recent development of genome-scale metabolic models for A. gossypii has expanded its biotechnological potential . While JID1's specific contribution to these applications isn't directly established in the search results, as a J-domain protein, it likely participates in:

  • Protein folding and quality control: Essential for efficient recombinant protein production

  • Stress response: Important during industrial fermentation processes

  • Protein homeostasis: Critical for metabolic engineering applications

Understanding JID1 function could contribute to engineering more robust A. gossypii strains for industrial applications by enhancing stress tolerance or improving recombinant protein folding.

What experimental considerations are important when studying JID1 in developmental processes?

When investigating JID1's role in developmental processes, researchers should consider multiple experimental approaches:

  • Visualization techniques:

    • Fluorescent protein tagging (e.g., GFP fusion) to track JID1 localization during different developmental stages

    • Similar approaches have been used for other A. gossypii proteins, such as Bni1p formin tagged with GFP to study its role in hyphal morphogenesis

  • Genetic manipulation:

    • Gene deletion using PCR-based targeting methods established for A. gossypii

    • Mutant phenotype characterization during developmental transitions

    • Complementation studies with wild-type or mutated JID1

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify JID1 binding partners

    • Co-immunoprecipitation to verify interactions in vivo

    • Binding assays to characterize interactions with Hsp70 chaperones

  • Functional assays:

    • Growth and morphology characterization under different stress conditions

    • Protein aggregation monitoring in JID1 mutants

    • Heat shock response analysis

How can researchers effectively measure JID1-substrate interactions?

To characterize JID1-substrate interactions, researchers can employ multiple complementary approaches:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Fluorescence anisotropy with labeled substrates

  • Identification of natural substrates:

    • Pull-down assays using tagged JID1 followed by mass spectrometry

    • Comparative proteomics between wild-type and JID1 mutant strains

    • Protein aggregation profiling in JID1-deficient cells

  • Functional chaperone assays:

    • Luciferase refolding assays to measure chaperone activity

    • Prevention of protein aggregation under stress conditions

    • ATPase stimulation assays with partner Hsp70 proteins

  • Structural studies:

    • NMR spectroscopy to map binding interfaces

    • X-ray crystallography of JID1-substrate complexes

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify regions involved in substrate binding

How can insights from Saccharomyces cerevisiae J-domain proteins inform JID1 research?

S. cerevisiae serves as an excellent model for understanding J-domain protein function due to extensive characterization of proteins like Ydj1. These insights can guide JID1 research:

  • Functional conservation:

    • Ydj1 in S. cerevisiae is a class A J-domain protein with zinc-binding domains

    • It contains the characteristic HPD motif in the J-domain essential for stimulating Hsp70 ATPase activity

    • The protein has a 1:2 molar ratio with zinc, coordinating one zinc ion in each zinc-binding domain

  • Structural elements:

    • Ydj1's crystal structure reveals specific arrangements of zinc-binding domains with Cys residues coordinating zinc ions

    • CD spectroscopy shows characteristic signatures of α-helical and β-sheet domains

  • Methodological approaches:

    • Techniques developed for Ydj1, such as zinc extraction methods, can be applied to JID1 studies

    • Functional assays established for Ydj1 can be adapted for JID1

  • Evolutionary context:

    • Comparing JID1 with Ydj1 and other fungal J-domain proteins can reveal evolutionarily conserved and divergent features

    • Such comparisons may highlight specialized functions in the filamentous growth context of A. gossypii

What role might JID1 play in Ashbya gossypii morphogenesis?

While the specific role of JID1 in A. gossypii morphogenesis isn't directly addressed in the search results, research on A. gossypii development provides context for generating hypotheses:

A. gossypii exhibits distinctive morphological development featuring hyphal tip splitting, which differs significantly from the budding growth of S. cerevisiae . Proteins like formins (including Bni1p) are critical for this process, playing essential roles in:

  • Hyphal emergence and elongation

  • Organization of actin cables

  • Tip-directed transport of secretory vesicles

As a J-domain protein, JID1 might contribute to morphogenesis through:

  • Quality control of morphogenetic proteins: Ensuring proper folding of proteins involved in hyphal growth

  • Stress response during development: Protecting cells during morphological transitions

  • Regulation of cytoskeletal components: Potentially interacting with proteins like formins or their regulators

  • Nuclear positioning: Supporting the unique multinucleated state of A. gossypii hyphae

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.