Recombinant Ashbya gossypii Mitochondrial escape protein 2 (YME2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ashbya gossypii Mitochondrial Escape Protein 2 (YME2)

Recombinant Ashbya gossypii Mitochondrial Escape Protein 2 (YME2) is a protein derived from the filamentous fungus Ashbya gossypii. This protein is part of the mitochondrial escape pathway, which plays a crucial role in maintaining mitochondrial function and integrity. The recombinant form of YME2 is often expressed in Escherichia coli and is tagged with a His-tag for easy purification and identification.

Characteristics of Recombinant Ashbya gossypii YME2

  • Species: Ashbya gossypii

  • Source: Expressed in Escherichia coli

  • Tag: N-terminal His-tag

  • Protein Length: Full-length mature protein (26-806 amino acids)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage: Store at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles

SpecificationDescription
UniProt IDQ751P7
Gene NameYME2
SynonymsYME2; AGL358C; Mitochondrial escape protein 2

Mitochondrial Function and Escape Proteins

Mitochondrial escape proteins, including YME2, are involved in maintaining mitochondrial integrity by facilitating the removal of damaged or dysfunctional mitochondrial components. This process is crucial for cellular health and function. While specific research on YME2 from Ashbya gossypii is limited, studies on similar proteins in other organisms suggest their importance in mitochondrial quality control .

Future Perspectives

Given the growing interest in Ashbya gossypii as a biotechnological tool, further research into proteins like YME2 could provide insights into mitochondrial function and biotechnological applications. The development of recombinant proteins in A. gossypii could also enhance our understanding of mitochondrial escape mechanisms and their role in cellular health.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YME2; AGL358C; Mitochondrial escape protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-806
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
YME2
Target Protein Sequence
RYISEDIQQKDAQAGEKATATATGVIYKSDEETLMYFDNVYPRATSLWRPTQWYNILLSN QSREAVREKIMRLASPASNPVHGLELRSTIPIKRDGGVFATFRVPREYTRAQVNALIQAN TQQESSKSLLAAFTRAAAFPVKGVPWIEDLKRLPNNVVRVEVEGPALSEEELYSLFRRYG TILDIYPAGKNGYATIRYRSFRGAICAKNCVSGIEINGSTLHVKFEPVVRAHAIRDFFVN HPRIAIPLLIALLSICAVLIFDPIREFSIEQKITRMYTLSRDNFVVKSILRLTSYTVSSV KHLWGYDDDQPEKRQLWQERVEKVNDLKMWLEENNNTFVVVTGPRGSGKHELVMQHTLHD RPNVLYLDCDTLIKSRTDSKFLRNAAHQIGYFPIFPWLNSVTTLVDLAVQGLTGQKSGLS ESKETQFRNMLNTAMMSIRHIALSGYKATLHSGDDVTTVKEEDYLQQHPERKPVIVIDRF SNKAEINGFVYKELADWASMLVQMNIAHVIFLTESVSPNQLLAEALPNQVFKFLFLSDAS KDSARSYVLSQLYPSSPAYSEKMPAADADANEEYRKEIDRALEPIGGRMLDLQAFVRRVK SGEEPSEALEKMVEQASEQITQIFLSERSEPIKTAQAWELIELLSQNDVVKYGDIVFRPL FKSSPEAGLLELEKNGLITISRNRGVLQDIRPAKPLFKAAFSYLLQDKDLSIVLRTGYYL RLIAFETGRIKKWEEELRLLAKVSDQRICKSRLNYLASKIDASSGVINSCEDKVKEMSKR I
Uniprot No.

Target Background

Function
This protein plays a crucial role in maintaining the mitochondrial genome and controlling mtDNA escape. It's involved in regulating mtDNA nucleotide structure and number. It may also have a secondary role in the early maturation of pre-rRNA.
Database Links
Protein Families
YME2 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of YME2 in Ashbya gossypii?

YME2 in Ashbya gossypii serves as a mitochondrial escape protein that prevents the unregulated transfer of mitochondrial DNA to the nucleus. Similar to its homolog in Saccharomyces cerevisiae, it appears to function as an integral inner mitochondrial membrane protein with its larger carboxyl-terminal domain facing the intermembrane space. Inactivation or deletion of the YME2 gene causes an increased rate of DNA escape from mitochondria to the nucleus, suggesting its critical role in maintaining mitochondrial genome integrity. This function appears to be conserved across fungal species, though the phenotypic manifestations may vary depending on the specific organism and strain background .

Research approaches to investigate YME2's function should include genetic knockout studies, localization experiments using fluorescent tags, and phenotypic characterization under various growth conditions. When studying growth phenotypes, it's essential to test both fermentable and non-fermentable carbon sources, as disruption of yme2 causes strain-dependent growth defects specifically on non-fermentable carbon sources, indicating its importance for respiratory function .

How does the structure of recombinant YME2 protein compare to the native form?

The recombinant form of YME2 currently available for research is a full-length mature protein spanning amino acids 26-806 of the native sequence, fused to an N-terminal His tag and expressed in E. coli. The complete amino acid sequence is available and includes characteristic domains necessary for its membrane integration and function .

When working with the recombinant protein, researchers should consider that while the primary sequence is preserved, post-translational modifications that may occur in Ashbya gossypii might be absent in the E. coli-expressed version. Additionally, the N-terminal His tag, while useful for purification, might potentially affect certain protein-protein interactions or conformational properties. Researchers investigating structure-function relationships should validate findings using complementary approaches such as in vivo expression systems in yeast or fungal models to confirm physiological relevance .

What genetic interactions have been observed between YME2 and other genes?

YME2 displays significant genetic interactions with YME1, another gene involved in mitochondrial DNA maintenance. These interactions manifest in several ways: mutations in yme2 suppress the cold-sensitive growth phenotype of yme1 mutants, suggesting a functional relationship where YME2 may act downstream or in a parallel pathway to YME1. Interestingly, yme1 yme2 double mutants exhibit a synthetic growth defect on ethanol-glycerol medium at 30°C, indicating that these genes also have some non-overlapping essential functions in mitochondrial maintenance .

Additionally, YME2 has been found to be identical to the previously cloned RNA12 gene, which when mutated (RNA12-1) creates a dominant temperature-sensitive phenotype preventing growth at 37°C. This connection suggests potential roles in RNA processing or maintenance that may be separate from its function in preventing mitochondrial DNA escape .

Researchers studying these genetic interactions should design experiments that test growth under various conditions (temperature, carbon sources) and combine mutations to observe synthetic effects. Complementation studies using plasmid-expressed wild-type genes can confirm the specificity of these interactions.

What are the optimal conditions for storing and reconstituting recombinant YME2 protein?

Based on manufacturer recommendations, recombinant YME2 protein requires careful handling to maintain its stability and activity. The protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. For long-term storage, it is advisable to reconstitute the protein and then add glycerol (to a final concentration of 5-50%) before aliquoting and storing at -20°C/-80°C .

For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • Store working aliquots at 4°C for no more than one week

The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability. When designing experiments, researchers should consider potential buffer compatibility issues with their specific assay systems. If buffer exchange is necessary, methods that minimize protein loss and denaturation, such as dialysis or desalting columns with appropriate molecular weight cutoffs, should be employed .

How can researchers effectively measure YME2 activity in vitro?

Measuring YME2 activity in vitro requires assays that reflect its function in preventing mitochondrial DNA escape. While no standardized activity assay is described in the provided literature, several approaches can be designed based on known properties of the protein:

  • DNA binding assays: Given YME2's role in DNA maintenance, electrophoretic mobility shift assays (EMSA) or fluorescence-based DNA binding assays using mitochondrial DNA fragments can assess binding affinity and specificity.

  • Membrane integration assays: As an integral inner membrane protein, reconstitution of YME2 into liposomes followed by protease protection assays can verify proper membrane orientation with the C-terminal domain facing outward (corresponding to the intermembrane space).

  • ATPase activity measurements: If YME2 functions similar to other mitochondrial maintenance proteins, it may exhibit ATPase activity that could be measured using standard phosphate release assays.

  • Interaction studies: Pull-down assays or surface plasmon resonance with potential partner proteins (especially YME1) can provide insights into functional complexes.

When developing these assays, researchers should include appropriate positive and negative controls, including denatured protein and buffer-only conditions. It's also advisable to validate in vitro findings with complementary in vivo approaches such as genetic complementation studies in yme2-null strains .

What experimental approaches can be used to study YME2 localization in Ashbya gossypii?

Studying YME2 localization in Ashbya gossypii requires techniques adapted to this filamentous fungus's unique cellular architecture. Unlike Saccharomyces cerevisiae, A. gossypii is multinucleate with nuclei dividing asynchronously in a common cytoplasm, presenting unique challenges for localization studies .

Effective experimental approaches include:

  • Fluorescent protein tagging: Creating C- or N-terminal GFP fusions of YME2 expressed from its native promoter. Given YME2's membrane topology, C-terminal tagging might better preserve function as the larger domain faces the intermembrane space. Researchers should verify that tagged constructs complement yme2 deletion phenotypes.

  • Immunofluorescence microscopy: Using antibodies against YME2 or its epitope tag combined with mitochondrial markers (like MitoTracker dyes) for co-localization studies.

  • Subcellular fractionation: Isolating mitochondria and further separating outer and inner membranes, followed by Western blotting to confirm YME2 enrichment in the inner membrane fraction.

  • Protease protection assays: Treating isolated mitochondria with proteases with and without membrane permeabilization to confirm the topology of YME2, particularly the orientation of the C-terminal domain.

When conducting these experiments in A. gossypii, researchers should consider the heterogeneous nature of mitochondria within this organism. Studies have shown substantial heterogeneity in mitochondrial morphology and membrane potential within a single multinucleated cell, which might influence YME2 distribution and function .

How does YME2 function differ between Ashbya gossypii and Saccharomyces cerevisiae?

While YME2 appears to serve similar core functions in both organisms—preventing mitochondrial DNA escape to the nucleus—several important differences may exist due to the distinct cellular organization and lifecycle of these fungi. Ashbya gossypii is a filamentous fungus with multinucleated compartments, while S. cerevisiae is a unicellular budding yeast .

Key comparative aspects to investigate include:

  • Expression patterns: In A. gossypii, does YME2 expression vary along the length of hyphae or correlate with mitochondrial distribution patterns? RNA-seq and in situ hybridization studies comparing expression patterns between the two organisms could reveal regulatory differences.

  • Functional conservation: Complementation experiments where A. gossypii YME2 is expressed in S. cerevisiae yme2 mutants (and vice versa) would demonstrate the degree of functional conservation. These experiments should measure mitochondrial DNA escape rates and growth phenotypes on various carbon sources.

  • Protein interaction networks: Immunoprecipitation followed by mass spectrometry in both organisms could reveal differences in protein interaction partners that might explain any functional divergence.

  • Response to environmental stress: Given the different ecological niches of these fungi, comparative studies of YME2 function under various stress conditions (temperature, oxidative stress, nutrient limitation) might reveal organism-specific adaptations.

Researchers should be aware that phenotypes resulting from YME2 disruption can be strain-dependent, particularly regarding growth on non-fermentable carbon sources, so multiple genetic backgrounds should be tested when making comparisons .

What role does YME2 play in mitochondrial morphology and membrane potential maintenance?

The relationship between YME2 and mitochondrial morphology/membrane potential represents an important research frontier. While direct evidence linking YME2 to these properties is limited in the provided literature, several experimental approaches can address this question:

  • Morphological analysis: Comparing mitochondrial morphology in wild-type versus yme2Δ strains using fluorescence microscopy with mitochondrial markers. Quantitative parameters to measure include mitochondrial length, branching frequency, and distribution patterns.

  • Membrane potential measurements: Using potential-sensitive dyes like JC-1 or TMRM to quantify changes in mitochondrial membrane potential in yme2 mutants compared to wild-type under various growth conditions.

  • Genetic interaction studies: Examining double mutants of yme2 with known mitochondrial morphology genes like DNM1 and FZO1 (fusion/fission machinery) could reveal functional relationships. The heterokaryons with a mixture of nuclei containing these gene deletions have already shown altered mitochondrial morphology and severe growth defects, suggesting potential interactions .

  • Electron microscopy: Ultrastructural analysis of mitochondria in yme2 mutants might reveal subtle changes in cristae organization or membrane integrity not visible by light microscopy.

It's worth noting that in A. gossypii, mitochondria exhibit substantial heterogeneity in both morphology and membrane potential within a single multinucleated cell, independent of nuclear division states. This natural variation should be considered when designing experiments and interpreting results related to YME2's impact on these properties .

How might post-translational modifications affect YME2 function?

The activity and localization of YME2 may be regulated by various post-translational modifications (PTMs), representing an advanced area of investigation. While specific information about YME2 PTMs is not provided in the search results, researchers can design experiments to explore this aspect:

  • Identification of PTMs: Mass spectrometry analysis of immunoprecipitated native YME2 from A. gossypii to identify phosphorylation, acetylation, ubiquitination, or other modifications. Comparing PTM patterns under different growth conditions or stress responses might reveal regulatory mechanisms.

  • Mutational analysis: Creating point mutations at potential modification sites (predicted using bioinformatics tools) and testing their impact on YME2 function, localization, and protein interactions.

  • Enzymatic regulation: Identifying kinases, phosphatases, or other enzymes that might modify YME2 through genetic or pharmacological screening approaches.

  • Comparison with recombinant protein: The recombinant YME2 expressed in E. coli likely lacks eukaryotic PTMs, providing a useful comparison point. Functional differences between native and recombinant proteins might be attributable to missing modifications.

Researchers should note that PTMs might be particularly important for regulating YME2 in response to metabolic changes or stress conditions. Experimental designs should include various growth conditions and stressors to capture the full spectrum of potential regulatory modifications.

What are common challenges when working with recombinant YME2 protein and how can they be addressed?

Researchers may encounter several challenges when working with recombinant YME2 protein, largely related to its nature as a membrane protein. Common issues and solutions include:

  • Protein solubility problems: As an integral membrane protein, YME2 may have limited solubility in aqueous buffers.

    • Solution: Include appropriate detergents (e.g., mild non-ionic detergents like DDM or Triton X-100) in buffers to maintain solubility.

    • Alternative approach: Consider using amphipols or nanodiscs for membrane protein stabilization in solution.

  • Protein aggregation during storage/thawing:

    • Solution: Follow strict storage recommendations, including aliquoting with glycerol addition (5-50% final concentration) and avoiding repeated freeze-thaw cycles .

    • Alternative approach: Store at 4°C for short-term use (up to one week) rather than freezing.

  • Loss of activity after reconstitution:

    • Solution: Reconstitute in recommended buffers (typically Tris/PBS-based buffer, pH 8.0) with 6% trehalose for stabilization .

    • Alternative approach: Add reducing agents like DTT or β-mercaptoethanol if disulfide bond formation is suspected.

  • Inconsistent results in functional assays:

    • Solution: Implement rigorous quality control for each batch, including SDS-PAGE to verify purity (>90%) and consistent protein concentration determination methods .

    • Alternative approach: Include internal standards in each experiment to normalize for batch-to-batch variation.

When troubleshooting, researchers should systematically document conditions that maintain YME2 stability and activity, as these may differ somewhat from published recommendations depending on specific experimental contexts.

How can researchers validate YME2 knockout phenotypes in Ashbya gossypii?

Validating YME2 knockout phenotypes in Ashbya gossypii requires careful experimental design to distinguish genuine effects from artifacts. Recommended approaches include:

  • Multiple independent knockout strains: Generate at least 3 independent yme2Δ strains to control for off-target effects or compensatory mutations.

  • Complementation tests: Reintroduce wild-type YME2 on a plasmid or integrated into the genome to verify that observed phenotypes are specifically due to YME2 loss.

  • Quantitative phenotyping: Use quantitative measures of:

    • Growth rates on different carbon sources (particularly non-fermentable ones)

    • Mitochondrial DNA escape rates (using appropriate marker systems)

    • Mitochondrial morphology and distribution parameters

    • Membrane potential using fluorescent dyes with quantitative microscopy

  • Control for strain background effects: Test knockouts in multiple genetic backgrounds, as YME2 disruption has shown strain-dependent phenotypes, particularly for growth on non-fermentable carbon sources .

  • Genetic interaction validation: Create double mutants with known interactors like YME1 to verify expected synthetic growth defects, such as the reported defect on ethanol-glycerol medium at 30°C in yme1 yme2 double mutants .

A comprehensive validation table should include the following measurements for wild-type, yme2Δ, and complemented strains:

ParameterWild-typeyme2Δyme2Δ + YME2 plasmid
Growth rate on glucose+++++++++
Growth rate on ethanol-glycerol++++ (strain-dependent)+++
mtDNA escape rateLowHighLow
Cold sensitivity---
Temperature sensitivity (37°C)-Variable-
Mitochondrial morphologyNormalTo be determinedNormal
Membrane potential heterogeneityHighTo be determinedHigh

What considerations are important when designing experiments to study YME2 in multinucleate cells?

Ashbya gossypii's multinucleate nature presents unique experimental challenges that must be addressed when studying YME2 function. Key considerations include:

  • Nuclear-cytoplasmic domains: In A. gossypii, nuclei divide asynchronously in a common cytoplasm, and the division cycle machinery may have a limited zone of influence. Researchers should consider whether YME2 expression or function varies within these nuclear-cytoplasmic domains .

  • Heterogeneous mitochondrial population: A. gossypii exhibits substantial heterogeneity in mitochondrial morphology and membrane potential within a single cell. Experimental designs must account for this natural variation when assessing YME2's impact .

  • Spatial sampling considerations: When analyzing phenotypes, researchers should sample multiple regions of the hyphal network rather than focusing on a single area, as conditions may vary along the length and age of hyphae.

  • Imaging challenges:

    • Use z-stack imaging to capture the full three-dimensional organization of mitochondria

    • Implement quantitative image analysis to objectively measure mitochondrial parameters

    • Consider time-lapse imaging to capture dynamic changes in mitochondrial behavior

  • Genetic manipulation approaches: Creating homogeneous mutant strains in A. gossypii can be challenging due to the multinucleate nature. Researchers should verify complete replacement of all nuclear copies of YME2 when creating knockout strains. Heterokaryon experiments (with mixed wild-type and mutant nuclei) can be particularly informative, as demonstrated with DNM1 and FZO1 genes .

  • Controls for nuclear cycle state: Since mitochondrial morphology and potential are independent of nuclear cycle state in A. gossypii, experiments should control for or at least document the division state of nearby nuclei when analyzing mitochondrial phenotypes in YME2 mutants .

By addressing these considerations, researchers can design more robust experiments that account for the unique cellular organization of A. gossypii when studying YME2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.