Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM14 (PAM18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM18; TIM14; ADR345C; Mitochondrial import inner membrane translocase subunit TIM14; Presequence translocated-associated motor subunit PAM18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
PAM18
Target Protein Sequence
MAPPTIEIPQLPIPGEDNSAHPAQQIRLEQAAVPQQKRGMDLYFDKVVDFVGEHPVVGGI GGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTKKRVK DVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGIRK
Uniprot No.

Target Background

Function
An essential component of the PAM complex. This complex is necessary for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within the complex, TIM14 is required to stimulate the activity of mtHSP70 (SSC1).
Database Links
Protein Families
TIM14 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of TIM14/PAM18 in mitochondrial protein import?

TIM14/PAM18 functions as a critical component of the TIM23 translocase complex in the mitochondrial inner membrane, where it operates alongside Pam16/Tim16 and the nucleotide exchange factor Mge1. The protein serves as a J-protein cochaperone that stimulates the ATPase activity of mitochondrial heat shock protein 70 (mhsp70), thereby providing the driving force for preprotein import into the mitochondrial matrix. This ATP-dependent motor activity is essential for the translocation of nuclear-encoded proteins bearing targeting sequences across the inner mitochondrial membrane. Notably, the deletion of TIM14/PAM18 has been demonstrated to be lethal in yeast, underscoring its indispensable role in mitochondrial biogenesis and cellular viability. The protein's function within the import machinery highlights the sophisticated mechanisms that have evolved to ensure proper protein compartmentalization within mitochondria.

How is the recombinant A. gossypii TIM14/PAM18 protein typically produced?

Recombinant A. gossypii TIM14/PAM18 is produced using homologous A. gossypii expression systems, taking advantage of the organism's genetic tractability and established biotechnological applications. The production process typically involves the integration of expression cassettes into the A. gossypii genome, as episomic vectors have shown limited stability in this organism . Researchers commonly employ promoters such as PGPD1, PTEF, or PPGK1 to drive strong constitutive expression of the target protein . The integrative expression cassettes used for TIM14/PAM18 production generally comprise recombinogenic flanks for targeted genomic integration, selectable markers like loxP-KanMX-loxP (conferring G418 resistance), the chosen promoter sequence, the TIM14/PAM18 coding sequence, and a terminator sequence . Recent advances include the implementation of CRISPR/Cas9-based editing techniques in A. gossypii, which enable marker-free engineering and more precise genomic modifications for enhanced protein production. Following expression, the recombinant protein requires careful handling during purification due to its thermal instability, with unfolding observed at temperatures as low as 35°C.

What structural characteristics define TIM14/PAM18 and how do they relate to its function?

TIM14/PAM18 exhibits several structural features critical to its role in mitochondrial protein import, most notably forming a heterodimer with Pam16/Tim16 that is essential for proper functioning of the import machinery. Circular dichroism (CD) spectroscopy has revealed that both recombinant Pam18/Tim14 and Pam16/Tim16 possess remarkably low thermal stability, with unfolding temperatures of approximately 35°C. This thermal instability suggests the proteins may undergo conformational changes during the import cycle, potentially contributing to the dynamic nature of the import process. Cross-linking experiments using disuccinimidyl suberate (DSS) have confirmed the formation of a stable Pam18/Tim14–Pam16/Tim16 heterodimer, which plays a crucial role in recruiting mhsp70 to the TIM23 channel. The J-domain of TIM14/PAM18 is particularly important for stimulating the ATPase activity of mhsp70, while its interaction with TIM23 positions it optimally to facilitate the translocation of incoming preproteins. These structural characteristics enable TIM14/PAM18 to coordinate the conversion of chemical energy from ATP hydrolysis into the mechanical force required for protein translocation across the mitochondrial inner membrane.

Why is A. gossypii particularly suitable for recombinant protein production?

A. gossypii presents several advantageous characteristics that make it particularly suitable for recombinant protein production, establishing it as an emerging expression system beyond its traditional role in riboflavin production . The filamentous fungus demonstrates an intrinsic ability to secrete both native and heterologous enzymes into the extracellular medium and can recognize signal peptides from other organisms as secretion signals, facilitating the efficient export of target proteins . A. gossypii can perform post-translational modifications, including glycosylation, producing N-glycans similar in extent to those produced by non-conventional yeasts such as Pichia pastoris . The organism's metabolism and genome have been extensively characterized, with the availability of genome-scale metabolic models enabling precise metabolic engineering strategies for optimized protein production . The development of a significant molecular and in silico modeling toolbox for A. gossypii manipulation, driven by its industrial relevance in riboflavin production, provides researchers with versatile methods for genetic modification and strain improvement . Additionally, culture optimization studies have shown that altering carbon sources, such as substituting glycerol for glucose, can enhance recombinant protein production by up to 1.5-fold, indicating substantial room for further improvement through media and cultivation condition optimization .

What methodological approaches can optimize the thermal stability of recombinant TIM14/PAM18 during purification and storage?

Given the documented thermal instability of recombinant TIM14/PAM18, which unfolds at temperatures as low as 35°C, implementing specialized methodological approaches during purification and storage is crucial for maintaining protein functionality. Researchers should consider implementing rapid purification protocols at temperatures below 30°C, potentially utilizing cold rooms or jacketed chromatography systems to maintain constant low temperatures throughout the process. The addition of stabilizing agents such as glycerol (typically 10-20%), reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues, and protease inhibitor cocktails can significantly enhance protein stability during purification. Co-purification with its binding partner Pam16/Tim16 should be considered, as the formation of the heterodimer has been shown through cross-linking experiments to enhance stability of both proteins. For long-term storage, flash-freezing aliquots in liquid nitrogen and maintaining at -80°C is recommended, with the inclusion of cryoprotectants such as glycerol or sucrose to prevent freeze-thaw damage. Before experimental use, researchers should verify protein integrity through circular dichroism spectroscopy or differential scanning fluorimetry to confirm that the protein retains its native conformation. Implementation of these methodological approaches can help overcome the inherent thermal instability of TIM14/PAM18, ensuring that functional protein is available for downstream experimental applications such as in vitro import assays or structural studies.

How can promoter selection and integration strategies be optimized for consistent TIM14/PAM18 expression in A. gossypii?

Optimizing promoter selection and integration strategies for consistent TIM14/PAM18 expression requires a systematic approach to genetic engineering in A. gossypii, taking into account both the strength and regulation of gene expression . Researchers should conduct comparative analyses of promoter activity using dual luciferase reporter assays, which provide improved experimental accuracy by employing Renilla luciferase as an internal control and firefly luciferase as the experimental reporter . Strong constitutive promoters like PGPD1, PTEF, and PPGK1 have been successfully used in A. gossypii for high-level expression, while the weaker PADH1 promoter may be suitable when more moderate expression is desired . For genomic integration, targeted approaches using recombinogenic flanks are recommended over episomic vectors, which show limited stability in A. gossypii . The integration cassettes should include a selectable marker such as loxP-KanMX-loxP, which confers G418 resistance and can later be eliminated via Cre recombinase expression for marker recycling in multi-gene modification strategies . Following transformation, researchers should select and verify positive primary heterokaryotic clones in G418-containing medium, then obtain homokaryotic clones through sporulation of primary transformants . Correct genomic integration should be confirmed by analytical PCR followed by DNA sequencing to ensure the integrity of the expression cassette . This systematic approach to promoter selection and integration ensures stable, consistent, and optimized expression of recombinant TIM14/PAM18 in A. gossypii expression systems.

How should researchers design experiments to assess the impact of TIM14/PAM18 mutations on mitochondrial protein import efficiency?

Designing experiments to assess the impact of TIM14/PAM18 mutations on mitochondrial protein import efficiency requires a comprehensive approach combining in vivo and in vitro methodologies. Researchers should first generate a panel of TIM14/PAM18 variants containing targeted mutations, focusing on conserved residues within the J-domain that stimulates mhsp70 ATPase activity and regions involved in interactions with other import components. For in vivo assessment, an experimental setup employing complementation assays in yeast or A. gossypii strains with conditionally regulated endogenous TIM14/PAM18 expression allows observation of phenotypic effects under varying conditions . Quantitative import assays using isolated mitochondria from cells expressing mutant TIM14/PAM18 variants and radiolabeled precursor proteins can directly measure import kinetics and efficiency, revealing specific defects in the import process. Biochemical characterization should include analysis of ATPase stimulation activity, where researchers measure the ability of mutant TIM14/PAM18 proteins to enhance mhsp70 ATP hydrolysis using colorimetric assays for inorganic phosphate release. Interaction studies employing techniques such as co-immunoprecipitation or pull-down assays with components of the import machinery can identify specific disruptions in protein-protein interactions caused by the mutations. Additionally, researchers should assess mitochondrial morphology and membrane potential using fluorescent dyes and confocal microscopy to detect broader impacts of TIM14/PAM18 dysfunction on mitochondrial health . This multi-faceted experimental approach enables comprehensive characterization of how specific mutations affect the molecular function of TIM14/PAM18 and their downstream consequences for mitochondrial protein import and cellular physiology.

How can researchers effectively compare expression levels of TIM14/PAM18 across different A. gossypii promoter systems?

To effectively compare expression levels of TIM14/PAM18 across different A. gossypii promoter systems, researchers should implement a systematic dual-reporter approach that controls for variations in growth conditions, cellular physiology, and technical factors . A dual luciferase reporter system provides exceptional precision by employing Renilla luciferase as an internal control and firefly luciferase as the experimental reporter linked to various promoters being evaluated . Researchers should construct genomic integrative cassettes for each promoter variant, ensuring consistent integration at defined genomic loci (such as ADR304W and AGL034C) to eliminate position effects that might confound expression comparisons . The integration cassettes should be verified through analytical PCR and DNA sequencing to confirm correct structure before proceeding with expression analysis . For quantification, cultures should be grown under standardized conditions, harvested at defined time points or growth phases, and processed according to established protocols for dual luciferase assays, with firefly luciferase activity normalized to Renilla luciferase to control for variations in cell density and extraction efficiency . Real-time quantitative PCR (RT-qPCR) can provide complementary data on mRNA levels, helping distinguish between transcriptional and post-transcriptional effects on protein expression . Additionally, western blot analysis with antibodies specific to TIM14/PAM18 or to epitope tags incorporated into the recombinant protein can directly quantify protein accumulation, while pulse-chase experiments can measure protein turnover rates to account for potential differences in protein stability rather than expression . This multi-faceted approach allows researchers to comprehensively characterize promoter performance, facilitating the selection of optimal expression systems for TIM14/PAM18 production.

What control experiments are essential when investigating the effects of recombinant TIM14/PAM18 in in vitro mitochondrial import assays?

When investigating the effects of recombinant TIM14/PAM18 in in vitro mitochondrial import assays, a comprehensive set of control experiments is essential to ensure result validity and accurate interpretation. Researchers must include negative controls consisting of import reactions conducted in the absence of ATP or in the presence of uncouplers like CCCP (carbonyl cyanide m-chlorophenyl hydrazone) that dissipate the membrane potential, confirming that observed import requires both energy sources and is not due to non-specific binding. Positive controls should utilize well-characterized precursor proteins with established import kinetics, such as Su9-DHFR (a fusion of the pre-sequence of subunit 9 of F1Fo-ATPase with dihydrofolate reductase), allowing comparison of experimental results with established benchmarks. Concentration-dependent controls in which varying amounts of recombinant TIM14/PAM18 are added to the import reaction can establish dose-response relationships and determine saturating concentrations. Thermal inactivation controls where aliquots of recombinant TIM14/PAM18 are heat-treated at 35°C or higher before addition to import reactions can verify that the observed effects require properly folded protein, given the known thermal lability of this protein. Competition assays using antibodies against TIM14/PAM18 or excess amounts of interacting partners like TIM16/PAM16 can confirm the specificity of observed effects. Additionally, parallel experiments using TIM14/PAM18 variants with mutations in functional domains (e.g., J-domain mutations that abolish mhsp70 ATPase stimulation) provide crucial information about structure-function relationships. These control experiments collectively ensure that the effects observed in in vitro import assays are specifically attributable to the functional activity of recombinant TIM14/PAM18 rather than experimental artifacts or non-specific interactions.

How can researchers distinguish between direct and indirect effects of TIM14/PAM18 dysfunction on mitochondrial phenotypes?

Distinguishing between direct and indirect effects of TIM14/PAM18 dysfunction on mitochondrial phenotypes requires a multi-layered experimental approach that can untangle the complex cascade of events following perturbation of this essential protein . Researchers should employ time-course analyses following conditional inactivation or depletion of TIM14/PAM18 to establish the temporal sequence of phenotypic changes, with early-onset effects more likely representing direct consequences of TIM14/PAM18 dysfunction . Substrate-specific import assays using various radiolabeled precursor proteins can identify which import pathways are preferentially affected, as direct effects would primarily impact proteins that utilize the TIM23 translocase complex where TIM14/PAM18 functions. Complementation experiments using TIM14/PAM18 variants with mutations in specific functional domains can link particular activities (e.g., J-domain function, TIM16/PAM16 binding) to specific phenotypic outcomes, helping establish direct mechanistic connections. Suppressor screens that identify genetic modifications rescuing TIM14/PAM18 phenotypes can reveal functional relationships and compensatory pathways, distinguishing primary defects from secondary adaptations . Mitochondrial stress response activation patterns, including mitochondrial unfolded protein response (UPRmt) markers, can indicate whether observed phenotypes result directly from import defects or represent downstream stress responses . Additionally, analyses of mitochondrial morphology and membrane potential in heterokaryon strains containing mixtures of nuclei with wild-type and mutant TIM14/PAM18 can provide insights into the local versus global nature of observed phenotypes, as dominant effects would suggest direct functional requirements . This systematic approach enables researchers to establish causal relationships between TIM14/PAM18 dysfunction and specific mitochondrial phenotypes, advancing understanding of its role in mitochondrial biogenesis and function.

What considerations are important when interpreting experimental data from multinucleate A. gossypii cells expressing recombinant TIM14/PAM18?

Interpreting experimental data from multinucleate A. gossypii cells expressing recombinant TIM14/PAM18 requires careful consideration of the organism's unique cellular biology and nuclear dynamics . Researchers must account for nuclear heterogeneity within a single mycelium, as genomic analyses have revealed that A. gossypii strains often contain heterozygous mutations with varying proportions of mutated reads (21-75%), indicating the presence of genetically distinct nuclei within individual cells . This nuclear diversity may lead to mosaic expression patterns of recombinant proteins, creating spatial variations in TIM14/PAM18 levels that could confound analyses of phenotypic effects or protein function . The asynchronous division of nuclei within a common cytoplasm means that different nuclei may be in different cell cycle states, potentially influencing expression from cell cycle-regulated promoters and creating temporal heterogeneity in protein production . When interpreting mitochondrial phenotypes, researchers should consider that A. gossypii exhibits substantial heterogeneity in mitochondrial morphology and membrane potential within single multinucleated cells, independent of nuclear division state, which could interact with or mask effects of recombinant TIM14/PAM18 expression . The limited diffusion of gene products within the large syncytial cells of A. gossypii suggests that recombinant TIM14/PAM18 may exert localized rather than global effects, as indicated by studies with mitochondrial fusion/fission gene products that appear to function primarily near their expression sites . Additionally, sporulation deficiencies observed in some engineered strains may limit propagation of specific nuclear genotypes, potentially selecting against nuclei expressing high levels of recombinant proteins that might be detrimental to cell function . These considerations highlight the importance of implementing appropriate experimental controls and employing techniques that can account for cellular heterogeneity when working with this unique organism.

How should data from thermal stability experiments on TIM14/PAM18 be integrated with functional import assays to develop a comprehensive understanding of structure-function relationships?

Integrating data from thermal stability experiments on TIM14/PAM18 with functional import assays requires a systematic analytical framework that connects structural transitions to functional outcomes across a range of conditions. Researchers should generate thermal denaturation profiles using circular dichroism spectroscopy and differential scanning calorimetry to establish precise melting temperatures and identify any intermediate states or domain-specific unfolding events in the TIM14/PAM18 protein or its complex with TIM16/PAM16. These profiles should then be correlated with activity measurements from functional import assays conducted at corresponding temperatures, creating temperature-activity relationships that reveal the thermal thresholds at which structural perturbations begin to impact function. Structure-guided mutagenesis targeting regions with different thermal stability characteristics can help establish which structural elements are most critical for maintaining functional activity, particularly focusing on the J-domain responsible for stimulating mhsp70 ATPase activity and regions mediating interactions with TIM16/PAM16. Hydrogen-deuterium exchange mass spectrometry performed at temperatures below, at, and above the onset of thermal denaturation can identify regions that become increasingly dynamic before complete unfolding, potentially revealing early molecular events that compromise function. Computational modeling, including molecular dynamics simulations at different temperatures, can provide atomic-level insights into the structural transitions that occur during thermal denaturation and predict their functional consequences. This integrated approach allows researchers to construct a detailed molecular model of how thermal-induced structural changes in TIM14/PAM18 progressively impact its ability to participate in mitochondrial protein import, informing both fundamental understanding of structure-function relationships and practical considerations for experimental design and protein handling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.