Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TIM22; ABL148C; Mitochondrial import inner membrane translocase subunit TIM22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TIM22
Target Protein Sequence
MVYRGFGLEHISPPVNKPFAEMTPEEQGERGAQMMMEFMTSCPGKSAISGVTGFALGGVF GLFMASMAYDTPLHTPAPVGAGPGAGIPGAPTLQQMADLPLKQQIKIQFADMGRRAYSSA KNFGYIGMIYSGVECTIESLRAKNDLYNGVAAGCLTGGGLAYKSGPSAALIGCAGFAAFS TAIDLYMRSENGRPPKNDFDE
Uniprot No.

Target Background

Function

Function: Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) is an essential core component of the TIM22 complex. This complex facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, TIM22 forms a voltage-activated and signal-gated channel, acting as a twin-pore translocase that utilizes the membrane potential as an external driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of TIM22 in Ashbya gossypii mitochondria?

TIM22 is an essential core component of the mitochondrial protein insertion complex in the inner membrane. It functions as the central component of the TIM22 pathway, which mediates the import of multitopic membrane proteins with internal targeting signals into the mitochondrial inner membrane. This protein combines three essential functions: signal recognition, channel formation, and energy transduction, all integrated into one central component . As a filamentous fungus used for industrial production of riboflavin and other metabolites, A. gossypii represents an important model organism for studying mitochondrial protein import mechanisms .

How does the TIM22 pathway function in mitochondrial protein import?

The TIM22 protein import pathway consists of two intermembrane space chaperone complexes (the Tim9-Tim10 and Tim8-Tim13 complexes) along with the core TIM22 complex. These components work together to facilitate the import of carrier proteins like the ADP/ATP and phosphate carriers into the inner mitochondrial membrane. Specifically, the Tim9-Tim10 complex binds to the substrate protein during an early stage of translocation when the substrate is crossing the outer membrane. Subsequently, TIM22 forms a channel that is voltage-activated and specifically responds to internal targeting signals, but not to presequences, facilitating the final insertion step .

What are the optimal conditions for storage and reconstitution of recombinant A. gossypii TIM22?

Recombinant A. gossypii TIM22 protein should be stored at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided. The lyophilized protein powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (the default concentration being 50%). Storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What expression systems have been successfully used for recombinant A. gossypii TIM22 production?

Recombinant full-length A. gossypii TIM22 protein has been successfully expressed in E. coli expression systems with N-terminal His tags. The protein typically includes the complete amino acid sequence (residues 1-201) of the native protein. Quality control typically verifies purity greater than 90% as determined by SDS-PAGE . Other expression systems may be viable but have not been reported in the available literature.

What methodological approaches can be used to study TIM22 channel activity?

Studies of TIM22 channel activity typically employ reconstitution of the purified protein into lipid bilayers for electrophysiological analysis. Key methodological approaches include:

  • Reconstitution of purified TIM22, potentially with other components of the import pathway

  • Voltage clamp experiments to measure channel conductance

  • Addition of peptides containing internal targeting signals to assess channel response

  • Comparative studies with presequence peptides as negative controls

These experiments have demonstrated that reconstituted TIM22 forms a hydrophilic, high-conductance channel that is voltage-activated and specifically responds to internal targeting signals but not to presequences .

How can small molecule inhibitors be used to elucidate TIM22 function?

Chemical-genetic approaches using small molecule inhibitors have proven valuable for studying TIM22 function. For example, MitoBloCK-1 was identified as a specific inhibitor that causes lethality to a tim10-1 yeast mutant at permissive temperature. This molecule selectively attenuates the import of carrier proteins, including the ADP/ATP and phosphate carriers, but not proteins that use other import pathways like TIM23 or Mia40/Erv1.

MitoBloCK-1 specifically impedes the binding of the Tim9-Tim10 complex to substrate proteins during early translocation stages. This approach revealed substrate specificity of the small Tim proteins, as MitoBloCK-1 impaired the import of Tim22 and Tafazzin, but not Tim23. Similar inhibition was observed in mammalian cells, confirming the conservation of the pathway and validating this approach for studying mitochondrial dysfunction linked to human disease .

ProteinAffected by MitoBloCK-1Import Pathway
ADP/ATP carrierYesTIM22
Phosphate carrierYesTIM22
Tim22YesTIM22
TafazzinYesTIM22
Tim23NoOther
TIM23 substratesNoTIM23

What genetic approaches can be used to study TIM22 function in A. gossypii?

Genetic approaches for studying TIM22 in A. gossypii may include:

  • Gene deletion/knockout studies (though TIM22 is likely essential as in other organisms)

  • Site-directed mutagenesis to identify critical residues for function

  • Creation of temperature-sensitive mutants for conditional studies

  • Random mutagenesis approaches, such as those using ethyl methane sulfonate (EMS)

Research in related fungi has shown that random mutagenesis with EMS can successfully generate mutants with altered protein secretion abilities. For example, in A. gossypii, EMS mutagenesis has produced strains with improved secretion of heterologous and native proteins . Similar approaches could potentially be adapted to study TIM22 function through the creation of conditional mutants.

How does the A. gossypii TIM22 complex compare functionally with homologs in other fungal species?

The TIM22 complex appears functionally conserved across fungal species, but with some notable differences:

  • Core function: In both A. gossypii and Saccharomyces cerevisiae, TIM22 serves as the essential core of the mitochondrial protein insertion complex for proteins with internal targeting signals.

  • Conservation: Orthologues of components of the import machinery exist in other yeast species such as A. gossypii , suggesting evolutionary conservation of the import mechanism.

  • Substrate specificity: Studies using inhibitors like MitoBloCK-1 have shown that the Tim9-Tim10 complex (which works with TIM22) mediates the import of a specific subset of inner membrane proteins, a principle likely conserved in A. gossypii .

  • Cross-species functionality: Experiments have shown that mitochondrial import mechanisms are sufficiently conserved that inhibitors identified in S. cerevisiae can also affect import in mammalian cells , suggesting potential conservation of function between A. gossypii and other eukaryotes.

How does TIM22 function relate to A. gossypii metabolic engineering applications?

A. gossypii is a filamentous fungus exploited for industrial production of riboflavin and has been engineered for the production of other metabolites including folic acid, nucleosides, and biolipids . As mitochondria are central to cellular metabolism, TIM22's role in maintaining proper mitochondrial protein import likely impacts these metabolic capabilities.

Research considerations include:

  • Potential effects of altered TIM22 expression on metabolic flux through mitochondrial pathways

  • Relationship between mitochondrial carrier protein import (mediated by TIM22) and metabolite transport across the inner membrane

  • Connections between mitochondrial function and riboflavin production pathways

  • Opportunities to optimize metabolic engineering by ensuring proper mitochondrial protein import

Metabolic engineering of A. gossypii relies on well-performing gene expression systems for both endogenous and heterologous genes , making the study of protein import mechanisms potentially valuable for optimizing these systems.

What analytical methods can be used to assess the impact of TIM22 mutations on A. gossypii mitochondrial proteome?

To evaluate how TIM22 mutations might affect the mitochondrial proteome of A. gossypii, researchers can employ several analytical approaches:

  • Comparative proteomics: Mass spectrometry-based proteomics to compare wild-type and mutant mitochondrial protein compositions

  • Import assays: In vitro and in vivo protein import assays using radiolabeled or fluorescently tagged substrate proteins

  • Blue native electrophoresis: To analyze the integrity of mitochondrial protein complexes

  • Respiration measurements: To assess functional impacts on oxidative phosphorylation

  • Membrane potential analyses: To determine if TIM22 mutations affect the mitochondrial membrane potential essential for protein import

These approaches can help determine which specific substrate proteins are most affected by TIM22 mutations and the consequent physiological impacts .

What factors might affect the functional reconstitution of recombinant A. gossypii TIM22?

Several factors can influence the successful functional reconstitution of recombinant TIM22:

  • Protein purity: Contaminants may interfere with proper folding or channel formation

  • Lipid composition: The specific phospholipids used for reconstitution can affect channel properties

  • Buffer conditions: pH, salt concentration, and other buffer components can impact protein stability and function

  • Reconstitution method: Different approaches (e.g., detergent removal, direct incorporation) may yield different results

  • Presence of other complex components: TIM22 may function optimally when reconstituted with other components of the import pathway

Researchers should systematically optimize these parameters to ensure proper channel formation and activity .

How can researchers validate the functional integrity of purified A. gossypii TIM22?

To confirm that purified recombinant TIM22 retains its native functional properties, researchers can employ several validation approaches:

  • Electrophysiological measurements: Reconstitute TIM22 in lipid bilayers and measure channel conductance and voltage dependence

  • Substrate binding assays: Assess binding of known TIM22 substrates using techniques such as surface plasmon resonance

  • Response to targeting signals: Test channel activation by peptides containing authentic internal targeting signals

  • Comparative analyses: Compare properties with well-characterized TIM22 from other species like S. cerevisiae

  • Complementation assays: Test whether the recombinant protein can complement TIM22 deficiency in a heterologous system

These approaches can provide confidence that the recombinant protein maintains its native functional characteristics .

What are the potential applications of studying A. gossypii TIM22 for understanding human mitochondrial diseases?

Research on A. gossypii TIM22 has several potential applications for understanding human mitochondrial diseases:

  • Conserved mechanism insights: Given that the TIM22 pathway is conserved from fungi to mammals, insights from A. gossypii can inform understanding of human mitochondrial protein import

  • Model for pathogenic mutations: Studies using MitoBloCK-1 have demonstrated that inhibitors identified in yeast models can also affect mammalian mitochondrial import, suggesting that A. gossypii could serve as a model for studying mutations associated with human diseases

  • Drug discovery platform: Understanding the structural and functional details of TIM22 could facilitate the development of therapeutic compounds targeting mitochondrial import in disease states

  • Evolutionary context: Comparative studies of TIM22 across species, including A. gossypii, can help identify critically conserved features that might be most relevant to human health

How might new genetic tools enhance the study of TIM22 function in A. gossypii?

Emerging genetic tools could significantly advance the study of TIM22 in A. gossypii:

  • CRISPR/Cas9 genome editing: For precise modification of the TIM22 gene and other components of the import pathway

  • Inducible expression systems: Development of tunable promoters in A. gossypii, such as those recently described (carbon source-regulatable) , could enable controlled expression of wild-type or mutant TIM22

  • Reporter systems: The adaptation of the Dual Luciferase Reporter (DLR) Assay for A. gossypii could potentially be modified to study TIM22 expression or function

  • Proteomics integration: Combining genetic manipulations with advanced proteomics approaches could provide comprehensive insights into TIM22 function and interactions

These methodological advances would complement existing approaches and potentially reveal new aspects of TIM22 biology in this important model organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.