Recombinant Ashbya gossypii Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGR1; AFR719W; Mitochondrial inner membrane i-AAA protease complex subunit MGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
MGR1
Target Protein Sequence
MALFTPPSEDKDGRDRSGGGDKASGVVRTPFHLRPSLGLALWGPLVPASDNRAGLWTLVG LQTLMGAFFVSRFRALRPKLLKRDIADFPSLNRFSKTSGDMHVGPVHVFADFGGTHSFHR RAGESPGFFQSRRFVSLKRALYLSTGVVLLVQSALESARLTLLVYDPWEEQARGVRDKQF YNDVVRYYHEGVDPARFIVKDPASGNTLPVNVPEVKQGVALARAHTNARNIITRWLGPLD CKPLSSSEFLDKLEHYLDTCDFIQDMNNKRLFGNPAEVKARQKALDALIQANKENRRRIR HILDITPPRGLPLSPKAVDQGLRSIILDPDHESTEDLDLHELWSIYNPWVDLALDTSLSI KFLPTVRTPEELLGDSEDTAVEQKNPPVQIKRERG
Uniprot No.

Target Background

Function
A component of the mitochondrial inner membrane i-AAA protease complex, essential for the turnover of mitochondrial inner membrane proteins.
Database Links
Protein Families
MGR1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MGR1 in the mitochondrial i-AAA protease complex?

MGR1 functions as an adapter protein that associates with the i-AAA protease complex in the mitochondrial inner membrane. Together with MGR3, it forms a subcomplex that binds to the i-AAA subunit Yme1p, the catalytic component of the complex. The primary function of MGR1 is to facilitate proteolysis by Yme1p through substrate recognition and recruitment. Loss of MGR1 has been shown to reduce the proteolytic activity of Yme1p, suggesting that MGR1 is necessary for maximal function of the i-AAA complex .

MGR1 specifically assists in targeting substrate proteins to the i-AAA protease for degradation. Experimental evidence indicates that MGR1 can bind to substrate proteins even in the absence of the catalytic Yme1p component, demonstrating its direct role in substrate recognition . This adapter function is particularly important for maintaining mitochondrial protein quality control and homeostasis.

How does MGR1 structurally interact with other components of the i-AAA protease complex?

MGR1 is a transmembrane protein localized to the mitochondrial inner membrane with a large domain extending into the intermembrane space (IMS). It forms a functional subcomplex with MGR3, another adapter protein with similar topology. This MGR1-MGR3 subcomplex then associates with the Yme1 protease to form the complete i-AAA complex .

Biochemical studies have shown that while MGR3 is essential for MGR1 stability, it is not required for the interaction between MGR1 and Yme1. Immunoprecipitation experiments demonstrate that MGR1-FLAG can pull down similar amounts of Yme1 regardless of whether MGR3 is present or not . This suggests a direct physical interaction between MGR1 and Yme1 that is independent of MGR3, although the complete functional complex requires all three components.

What phenotypes are associated with MGR1 deletion in model organisms?

Deletion of MGR1 results in reduced proteolysis of i-AAA substrates, as demonstrated in yeast models. Specifically, MGR1 deletion significantly inhibits the degradation of proteins like Tom22-HA and Om45-HA that are known substrates of the i-AAA protease complex . The phenotypic effects of MGR1 deletion are similar to those observed with MGR3 deletion, suggesting functional overlap or cooperation between these adapter proteins.

In broader phenotypic screens, mgr1Δ mutants behaved more similarly to mgr3Δ mutants than to nearly 5000 other yeast knockout strains when exposed to hundreds of different conditions, further supporting their functional association . This phenotypic clustering provides strong evidence for their shared biological role as part of the same protein complex.

What expression systems are most effective for recombinant production of MGR1 in A. gossypii?

For recombinant protein expression in A. gossypii, the choice of promoter significantly impacts production levels. Early attempts at recombinant protein expression in A. gossypii used heterologous promoters from Saccharomyces cerevisiae (such as ScPGK1), but these were found to be inefficient in A. gossypii . Subsequent research demonstrated that native A. gossypii promoters, particularly AgTEF and AgGPD, can improve recombinant protein production by up to 8-fold compared to the ScPGK1 promoter .

For MGR1 expression specifically, these findings suggest that a construct using the native AgTEF or AgGPD promoters would likely yield higher expression levels. Additionally, removing unnecessary terminator sequences (such as ScADH1 terminator, which has been reported to display autonomous replicating sequence activity in A. gossypii) can provide a 2-fold improvement in recombinant protein production .

How can culture conditions be optimized to enhance recombinant MGR1 production in A. gossypii?

The choice of carbon source significantly affects recombinant protein production in A. gossypii. Research has shown that using glycerol instead of glucose as the carbon source can increase recombinant protein production by approximately 1.5-fold . This suggests that for optimal MGR1 production, cultivation media containing glycerol would likely be more effective than glucose-based media.

Additionally, culture optimization should consider A. gossypii's growth characteristics. The fungus grows as filamentous mycelia, and environmental factors such as pH and temperature can influence both growth and protein expression. While specific conditions for MGR1 haven't been directly studied, general research on A. gossypii indicates that standard growth occurs at temperatures between 22°C and 37°C, with no significant differences in radial growth observed between wild-type and various mutant strains within this temperature range .

What secretion signal sequences are most effective for recombinant MGR1 expression?

The effectiveness of secretion signal sequences for recombinant protein expression in A. gossypii remains an area requiring further research. Current literature indicates that this is an underexplored aspect that holds potential for improving heterologous protein production . For mitochondrial proteins like MGR1, which naturally contain targeting sequences for mitochondrial import, the design of expression constructs should carefully consider whether to maintain the native mitochondrial targeting sequence or replace it with a secretion signal.

How does the MGR1-MGR3 adapter complex recognize and select substrates for degradation?

The MGR1-MGR3 adapter complex recognizes substrates through direct interaction with domains exposed to the intermembrane space (IMS). Research using immunoprecipitation and in vivo site-specific photo-cross-linking has demonstrated that both MGR1 and MGR3 can recognize the IMS domains of substrate proteins and facilitate their recruitment to Yme1 for proteolysis . This recognition appears to be specific, as the complex targets particular proteins for degradation rather than indiscriminately binding to all proteins in the IMS.

Interestingly, the MGR1-MGR3 complex can bind substrate proteins even in the absence of Yme1, indicating that these adapter proteins play a primary role in substrate recognition before transferring the substrate to the catalytic Yme1 component for degradation . The molecular details of this recognition, including specific binding motifs or structural features that determine substrate selectivity, remain important areas for further investigation.

What is the role of MGR1 in the degradation of mitochondrial outer membrane proteins?

Recent research has revealed an unexpected role for the Yme1-MGR1-MGR3 complex in degrading certain mitochondrial outer membrane (MOM) proteins, such as Tom22 and Om45. This finding was surprising because the i-AAA protease complex is located in the inner membrane with its catalytic domain facing the intermembrane space, while MOM proteins reside in a different membrane compartment .

The mechanism appears to involve the recognition of IMS-exposed domains of these MOM proteins by MGR1 and MGR3, followed by recruitment to Yme1. Evidence suggests that the cytoplasmic domain of these substrate proteins can be dislocated into the IMS through the ATPase activity of Yme1 . This indicates a novel proteolysis pathway that monitors MOM proteins from the IMS side, complementing the cytoplasmic quality control mechanisms such as the ubiquitin-proteasome system.

How does the ATPase activity of Yme1 coordinate with MGR1-MGR3 function?

The i-AAA protease Yme1 contains an ATPase domain that provides energy for protein unfolding and translocation during the degradation process. Research indicates that this ATPase activity is crucial for the dislocation of substrate domains from one compartment to another, such as moving cytoplasmic domains of MOM proteins into the IMS where they can be degraded by the protease complex .

While MGR1 and MGR3 are responsible for substrate recognition and binding, the ATPase activity of Yme1 appears to drive the subsequent steps of substrate processing. Mutations affecting the ATPase activity of Yme1 (such as the E541Q mutation) impair substrate degradation even when the interaction between Yme1 and MGR1 remains intact . This suggests a functional coordination where MGR1-MGR3 first recognize and bind substrates, and then Yme1's ATPase activity enables the translocation and unfolding necessary for proteolysis.

What genetic modification strategies are most effective for studying MGR1 function in A. gossypii?

For genetic manipulation of A. gossypii to study MGR1 function, PCR-based gene targeting approaches have proven effective. This method involves generating deletion cassettes containing selectable markers flanked by sequences homologous to the target gene. These cassettes can then be transformed into A. gossypii, where they integrate into the genome through homologous recombination .

A. gossypii is multinucleated, which presents unique challenges for genetic modification. To obtain homokaryotic mutants (where all nuclei contain the same mutation), researchers typically use antibiotic selection methods. For instance, spores can be isolated on G418-containing media to select for those carrying the integrated selection marker. These spores germinate to generate homokaryotic mycelia harboring only nuclei with the linked mutation . When studying MGR1, it's advisable to generate and analyze at least two independent mutant strains to confirm that observed phenotypes are due to the specific gene deletion rather than secondary mutations.

What biochemical approaches are most informative for characterizing MGR1-protein interactions?

Immunoprecipitation (IP) has proven highly effective for studying the interactions of MGR1 with other proteins. By adding epitope tags (such as FLAG) to MGR1, researchers can isolate the protein along with its binding partners from cellular extracts. This approach has successfully demonstrated the interaction between MGR1 and Yme1, as well as the dependence of this interaction on various factors .

In vivo site-specific photo-cross-linking provides another powerful approach for capturing transient interactions between MGR1 and its substrates. This technique involves incorporating photo-activatable amino acid analogs at specific positions within proteins, which can then be activated by UV light to form covalent bonds with nearby molecules. This has been used to demonstrate that MGR1 directly recognizes the IMS domains of substrate proteins .

How can proteomics approaches be applied to identify MGR1 substrates in A. gossypii?

Comparative proteomics between wild-type and MGR1-deleted A. gossypii strains represents a powerful approach for identifying potential MGR1 substrates. By comparing the abundance of proteins in mitochondrial fractions from both strains, researchers can identify proteins that accumulate in the absence of MGR1, suggesting that they are normally degraded in an MGR1-dependent manner.

Stable isotope labeling with amino acids in cell culture (SILAC) combined with mass spectrometry could provide quantitative information about protein turnover rates. By pulse-labeling proteins and following their degradation over time in wild-type versus MGR1-deleted strains, researchers can identify proteins whose degradation kinetics are specifically affected by the absence of MGR1.

Additionally, proximity labeling approaches such as BioID or APEX could be used to identify proteins that come into close proximity with MGR1 in vivo. By fusing a promiscuous biotin ligase to MGR1, researchers can biotinylate proteins that interact with or come close to MGR1, allowing their subsequent purification and identification by mass spectrometry.

What are the major challenges in achieving high-yield expression of recombinant MGR1 in A. gossypii?

Several challenges hinder high-yield expression of recombinant proteins like MGR1 in A. gossypii. First, the choice of expression vector and promoter significantly impacts production. Early attempts using heterologous promoters from S. cerevisiae resulted in very low yields . Although native A. gossypii promoters (AgTEF and AgGPD) have improved yields by up to 8-fold, further optimization may be necessary for membrane proteins like MGR1.

Second, the integration site and stability of expression cassettes affect long-term production. Developing strategies for integrating stable expression cassettes, rather than relying on plasmid-based expression, appears crucial for maximizing heterologous protein production in A. gossypii . For membrane proteins like MGR1, additional challenges include ensuring proper targeting to the mitochondrial inner membrane and maintaining the correct topology for function.

Finally, optimizing culture conditions (carbon source, media composition, pH) can significantly impact recombinant protein yields in A. gossypii. The finding that glycerol as a carbon source increases recombinant protein production by 1.5-fold compared to glucose indicates that metabolic optimization may be an important avenue for improvement .

What potential biotechnological applications could emerge from research on the MGR1 i-AAA protease system?

Understanding the MGR1-mediated mitochondrial quality control system could lead to several biotechnological applications. First, manipulating this system might enhance the production of recombinant proteins in A. gossypii by improving mitochondrial function and cellular energetics. A. gossypii has already been established as a promising host for heterologous protein production, and optimizing its mitochondrial quality control could further enhance its productivity .

Second, insights into protein degradation mechanisms could inform strategies for controlling the stability of industrially relevant enzymes. A. gossypii is used for industrial production of various compounds including riboflavin, and understanding how to protect key metabolic enzymes from degradation could improve production yields .

Finally, knowledge of the i-AAA protease system could be applied to metabolic engineering efforts in A. gossypii. The fungus has been engineered for the production of various compounds, including inosine (with yields increased up to 150-fold through metabolic engineering) . Ensuring robust mitochondrial function through optimized quality control systems could support these metabolic engineering efforts by maintaining cellular health under the stress of engineered metabolic pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.