Recombinant Ashbya gossypii Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2; ADR359W; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-423
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
MRS2
Target Protein Sequence
AQGPAFFVKPITPNDLFVSCTVFNEKGAVTGVSERYPKLSFLRDRGLYPRDLRKLDTSSI EVIPSIVVKPTCILVNLLHIKAVIEKNRVYVFDTTSKEAAARLGVLMYDLESKLASHSSQ PAQHYEHRALESILVNVMTCLETEFKHLSKQCGLVLNELEDQIDRDKLRDLLIHSKDLTS FYQKSLLIRDMLDELLESDEDLAAMCLSPAPGTVEADAAEVEMLLETYYKQCDEYVQQSG SLLQNIKSTEDVVNIILDANRNSLMLFELKVTIYTLGFTVATLLPAFCGMNLKNFIEESV WGFGGVLAVSAVAGLAVTASNFKALRNVARLTVMNSHSTSPGAKNISSARLHLDRDVPTL WMRLKTAFRTIWFGKSRPSRDGRQRDMIWKWLLDDTSK
Uniprot No.

Target Background

Function
Recombinant *Ashbya gossypii* Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) is a high-conductance magnesium-selective channel facilitating magnesium influx into the mitochondrial matrix. It plays a crucial role in the splicing of mitochondrial group II introns by modulating mitochondrial magnesium concentrations, essential for this process. Furthermore, MRS2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the MRS2 transporter in Ashbya gossypii and why is it important for research?

The MRS2 protein in Ashbya gossypii functions as a mitochondrial inner membrane magnesium transporter that plays a crucial role in maintaining magnesium homeostasis within mitochondria. Magnesium is an essential cofactor for numerous mitochondrial enzymes, including those involved in ATP production and nucleic acid metabolism. In A. gossypii, which naturally overproduces riboflavin (vitamin B2), MRS2 is particularly significant as riboflavin production involves numerous magnesium-dependent enzymes. Research on MRS2 provides insights into the fundamental processes of magnesium transport and its influence on mitochondrial function and metabolism in filamentous fungi. While MRS2 is not specifically mentioned in the available genomic studies of riboflavin-overproducing A. gossypii mutants, mitochondrial function has been implicated in the organism's metabolism and riboflavin production capacity .

How does A. gossypii MRS2 compare structurally to homologous proteins in other organisms?

The A. gossypii MRS2 belongs to the CorA/MRS2/Alr1 superfamily of magnesium transporters found across bacteria, fungi, plants, and animals. The protein typically contains two transmembrane domains with a characteristic GMN (Glycine-Methionine-Asparagine) motif at the end of the first transmembrane domain, which is crucial for magnesium selectivity. Comparative structural analysis shows that A. gossypii MRS2 shares significant similarity with its Saccharomyces cerevisiae homolog, which is expected given that 91% of annotated A. gossypii genes are syntenic to those of S. cerevisiae . The N-terminal region contains a mitochondrial targeting sequence that directs the protein to the inner mitochondrial membrane. To perform structural comparisons, researchers typically use bioinformatic tools such as BLAST, multiple sequence alignment software (CLUSTAL, MUSCLE), and protein modeling platforms (SWISS-MODEL, I-TASSER) to identify conserved domains and predict structural features.

What role does the MRS2 transporter play in A. gossypii metabolism?

The MRS2 transporter in A. gossypii facilitates magnesium influx into mitochondria, which is critical for various metabolic processes. Magnesium serves as a cofactor for enzymes involved in:

  • The tricarboxylic acid (TCA) cycle

  • Oxidative phosphorylation

  • RNA synthesis and processing

  • Mitochondrial DNA replication

Given A. gossypii's natural ability to overproduce riboflavin, which requires FAD as a cofactor in many reactions, proper magnesium homeostasis maintained by MRS2 likely influences the organism's metabolic flux. In related organisms, disruption of MRS2 function has been associated with altered mitochondrial membrane potential, respiratory deficiencies, and growth defects. Genomic analyses of riboflavin-overproducing A. gossypii strains have revealed mutations in genes encoding flavoproteins and enzymes involved in oxidation-reduction processes, suggesting that mitochondrial function, which depends on proper magnesium transport, may be linked to riboflavin production capacity .

How might mutations in the A. gossypii MRS2 gene influence riboflavin overproduction?

Mutations in the A. gossypii MRS2 gene could potentially influence riboflavin overproduction through several mechanisms:

  • Altered mitochondrial magnesium homeostasis might affect the activity of flavoenzymes that require magnesium as a cofactor. Genomic analysis of riboflavin-overproducing A. gossypii strains has identified mutations in genes encoding flavoproteins such as AgILV2 (acetohydroxyacid synthase), which requires FAD as a cofactor .

  • Changes in magnesium transport could influence mitochondrial membrane potential and oxidative phosphorylation, potentially altering the redox balance within the cell. Previous research has shown that riboflavin-overproducing Ashbya mutants accumulate reactive oxygen species (ROS) and are vulnerable to oxidative DNA damage , suggesting a link between oxidative stress and riboflavin production.

  • Mitochondrial dysfunction resulting from impaired magnesium transport might trigger compensatory mechanisms, including increased riboflavin synthesis, as part of a cellular stress response. Gene ontology enrichment analysis of riboflavin-overproducing mutants revealed heterozygous mutations in genes involved in oxidation-reduction processes , which might be influenced by altered magnesium homeostasis.

To investigate these hypotheses, researchers would need to generate specific MRS2 mutants in A. gossypii and analyze their phenotypes regarding riboflavin production, mitochondrial function, and magnesium homeostasis using techniques such as site-directed mutagenesis, riboflavin quantification assays, and magnesium-sensitive fluorescent probes.

What is the relationship between mitochondrial magnesium transport and oxidative stress in A. gossypii?

The relationship between mitochondrial magnesium transport via MRS2 and oxidative stress in A. gossypii represents an important area of investigation:

  • Magnesium deficiency in mitochondria can lead to electron transport chain dysfunction, resulting in increased ROS production. Genomic analysis of riboflavin-overproducing A. gossypii mutants has shown that these strains accumulate ROS , which might be partially attributed to altered mitochondrial magnesium homeostasis.

  • Proper magnesium levels are required for the activity of mitochondrial antioxidant enzymes such as superoxide dismutase (SOD), which depends on metal cofactors for function. Reduced magnesium availability could compromise antioxidant defenses.

  • Riboflavin production in A. gossypii appears to be associated with aging phenotypes and oxidative stress. Silva et al. demonstrated that riboflavin-overproducing Ashbya mutants are vulnerable to photoinduced oxidative DNA damage and accumulate ROS , suggesting that riboflavin overproduction, which might be influenced by MRS2 function, is linked to oxidative stress.

Experimental approaches to study this relationship would include measuring ROS levels in wild-type and MRS2 mutant strains using fluorescent probes (e.g., DCFDA, MitoSOX), assessing mitochondrial membrane potential, and quantifying oxidative damage to proteins, lipids, and DNA in response to altered MRS2 expression or function.

How does the multinucleate nature of A. gossypii influence MRS2 expression and function across different cell compartments?

A. gossypii is a naturally multinucleate filamentous fungus, which presents unique challenges and opportunities for studying genes like MRS2:

  • Heterogeneous expression: Genomic analysis of A. gossypii mutants has revealed variable proportions of mutated reads in different genes, ranging from 21% to 75%, suggesting that multiple nuclei within the same cell may contain different mutations . This heterogeneity could result in differential expression of MRS2 across nuclei within the same hypha.

  • Localized function: With multiple nuclei controlling different cellular regions, MRS2 expression and mitochondrial magnesium transport could vary along the length of hyphae, potentially creating magnesium concentration gradients that influence local metabolic activities.

  • Nuclear-mitochondrial communication: The presence of multiple nuclei might enable sophisticated regulation of mitochondrial function through nucleus-specific expression of MRS2 and other mitochondrial proteins.

Studying this aspect would require advanced imaging techniques such as:

  • Fluorescent tagging of MRS2 combined with live-cell imaging

  • Nucleus-specific labeling to correlate nuclear position with MRS2 expression

  • Magnesium-sensitive fluorescent probes to map mitochondrial magnesium concentrations across the cell

These approaches would help elucidate how the multinucleate nature of A. gossypii influences MRS2 distribution and function across different cellular compartments.

What are the optimal techniques for cloning and expressing recombinant A. gossypii MRS2?

Cloning and expressing recombinant A. gossypii MRS2 requires careful consideration of several factors:

Cloning strategies:

  • PCR amplification of the A. gossypii MRS2 gene from genomic DNA or cDNA, with consideration for potential introns

  • Selection of appropriate restriction sites for directional cloning

  • Use of gateway cloning systems for versatile vector compatibility

Expression systems:

  • E. coli expression: Suitable for producing protein for structural studies, but may require optimization of codon usage and removal of mitochondrial targeting sequences

  • Yeast expression (S. cerevisiae): Offers a eukaryotic environment closer to the native host

  • Homologous expression in A. gossypii: Most physiologically relevant but potentially challenging due to the organism's filamentous nature

Purification approaches:

  • Addition of affinity tags (His6, GST, etc.) for purification

  • Consideration of tag position (N-terminal vs. C-terminal) to avoid interference with protein function

  • Membrane protein solubilization using appropriate detergents (e.g., DDM, LDAO)

Functional verification:

  • Complementation assays in MRS2-deficient yeast strains

  • Magnesium uptake assays using radioisotopes (28Mg2+) or fluorescent indicators

  • Electrophysiological measurements of magnesium transport

These methodological considerations must be tailored to the specific research questions being addressed and may require optimization based on the unique characteristics of A. gossypii as a filamentous fungus.

What experimental approaches are most effective for studying MRS2-dependent magnesium transport in A. gossypii mitochondria?

Studying MRS2-dependent magnesium transport in A. gossypii mitochondria requires specialized techniques:

Mitochondrial isolation:

  • Enzymatic digestion of the cell wall followed by mechanical disruption

  • Differential centrifugation to isolate intact mitochondria

  • Percoll gradient purification to obtain highly purified mitochondria

Magnesium transport assays:

  • Mag-fura-2 fluorescent indicator to measure free Mg2+ concentrations

  • Isotopic techniques using 28Mg2+ to track magnesium movement

  • Patch-clamp electrophysiology for direct measurement of magnesium currents

Genetic manipulation approaches:

  • CRISPR/Cas9-mediated gene editing to generate MRS2 knockouts or introduce specific mutations

  • Conditional expression systems to regulate MRS2 levels

  • Fluorescent protein tagging for localization studies

Physiological measurements:

  • Oxygen consumption rate (OCR) measurements to assess respiratory function

  • Membrane potential assays using potentiometric dyes (TMRM, JC-1)

  • ATP production assays to evaluate energetic consequences of altered magnesium transport

These techniques can be combined with the genomic analysis approaches that have been successfully applied to study riboflavin-overproducing A. gossypii mutants , providing a comprehensive understanding of MRS2 function in this organism.

How can researchers effectively manipulate the MRS2 gene in A. gossypii considering its multinucleate nature?

Manipulating the MRS2 gene in A. gossypii presents unique challenges due to the organism's multinucleate nature:

Transformation strategies:

  • Spore transformation: Although the riboflavin-overproducing strain described in the literature did not sporulate under the conditions tested , wild-type A. gossypii strains produce haploid spores that can be transformed and germinated to produce homokaryotic transformants.

  • Protoplast transformation: Enzymatic removal of the cell wall followed by PEG-mediated DNA uptake

  • Agrobacterium-mediated transformation: Utilizing T-DNA transfer for gene insertion

Ensuring complete gene replacement:

  • Strong selection markers to ensure dominance in all nuclei

  • Multiple rounds of selection to promote homogenization of nuclei

  • Single spore isolation to establish homokaryotic strains

Verification of multinuclear genotype:

  • Next-generation sequencing to determine the proportion of modified alleles, similar to the approach used to characterize heterozygous mutations in riboflavin-overproducing strains (showing different proportions of mutated reads ranging from 21% to 75%)

  • Fluorescence in situ hybridization (FISH) to visualize the presence/absence of the modified gene in individual nuclei

  • Digital droplet PCR for precise quantification of wild-type versus modified alleles

Phenotypic analysis approaches:

  • Growth assessments under different magnesium concentrations

  • Mitochondrial function tests (respiration, membrane potential)

  • Riboflavin production quantification to assess metabolic consequences

These approaches must account for the possibility that different nuclei within the same mycelium may contain different versions of the MRS2 gene, creating potential heterogeneity in phenotypic outcomes.

How does MRS2-mediated magnesium transport interact with riboflavin biosynthesis pathways in A. gossypii?

The interaction between MRS2-mediated magnesium transport and riboflavin biosynthesis represents an important research area:

Enzymatic dependencies:

  • Magnesium serves as a cofactor for multiple enzymes in the riboflavin biosynthetic pathway, including GTP cyclohydrolase II and riboflavin synthase

  • The purine biosynthetic pathway, which provides precursors for riboflavin synthesis, includes multiple magnesium-dependent steps

Metabolic connections:

  • Proper mitochondrial function, which depends on magnesium homeostasis, influences the availability of metabolic precursors for riboflavin synthesis

  • Reinforcement of the purine biosynthetic pathway has been shown to improve riboflavin production in A. gossypii , which may be influenced by magnesium availability

Regulatory interactions:

  • Oxidative stress, which has been linked to riboflavin overproduction in A. gossypii , may be modulated by mitochondrial magnesium levels

  • The aging of cells, associated with riboflavin production in A. gossypii , might be influenced by mitochondrial function and magnesium homeostasis

Research approaches to investigate these interactions would include metabolic flux analysis combining isotope labeling with mass spectrometry, transcriptomic and proteomic profiling of wild-type and MRS2-modified strains, and in vitro enzyme activity assays under varying magnesium concentrations.

What role might MRS2 play in the adaptation of A. gossypii to industrial production conditions?

MRS2 may play significant roles in adapting A. gossypii to industrial production conditions:

Stress responses:

  • Industrial fermentation subjects cells to various stresses (oxidative, osmotic, pH) that might influence mitochondrial function and magnesium requirements

  • Riboflavin-overproducing Ashbya mutants accumulate reactive oxygen species (ROS) , suggesting that magnesium homeostasis might be important for managing oxidative stress during production

Energy metabolism:

  • MRS2-mediated magnesium transport is essential for mitochondrial ATP production

  • High-yield riboflavin production requires efficient energy metabolism to support biosynthetic processes

Cell aging and productivity:

  • Industrial strains often undergo extended cultivation periods

  • The link between riboflavin production and cell aging observed in A. gossypii suggests that MRS2's role in maintaining mitochondrial function might influence strain longevity and productivity

Media optimization:

  • Magnesium availability in industrial media could influence MRS2 function and mitochondrial performance

  • Optimization of magnesium supplementation might enhance riboflavin production by supporting MRS2-dependent processes

Experimental approaches would include testing MRS2-modified strains under industrial conditions, analyzing the effects of different magnesium concentrations on production parameters, and long-term cultivation studies to assess strain stability and productivity.

What emerging technologies could advance our understanding of MRS2 function in A. gossypii?

Several emerging technologies show promise for advancing research on A. gossypii MRS2:

Advanced imaging techniques:

  • Super-resolution microscopy to visualize MRS2 distribution within mitochondrial membranes

  • Multi-color live-cell imaging to track magnesium dynamics alongside other cellular parameters

  • Correlative light and electron microscopy to link MRS2 localization with mitochondrial ultrastructure

Single-nucleus genomics and transcriptomics:

  • Technology to isolate and analyze individual nuclei from multinucleate A. gossypii cells

  • Assessment of nucleus-specific MRS2 expression patterns

  • Correlation of nuclear genotype with local mitochondrial phenotypes

Mitochondrial proteomics:

  • Proximity labeling approaches to identify MRS2 interaction partners

  • Quantitative proteomics to assess changes in mitochondrial protein composition in response to altered MRS2 function

  • Post-translational modification analysis to understand MRS2 regulation

Systems biology approaches:

  • Integration of genomic, transcriptomic, proteomic, and metabolomic data to develop comprehensive models of MRS2 function

  • Flux balance analysis incorporating magnesium homeostasis parameters

  • Genome-scale metabolic modeling to predict the effects of MRS2 modifications on riboflavin production

These technologies would complement the genomic analysis approaches that have been applied to study riboflavin-overproducing A. gossypii mutants , providing deeper insights into the molecular mechanisms of MRS2 function.

How can structural biology approaches contribute to understanding A. gossypii MRS2 function and regulation?

Structural biology approaches offer powerful tools for understanding A. gossypii MRS2:

Protein structure determination:

  • X-ray crystallography of purified MRS2 protein to determine atomic-level structure

  • Cryo-electron microscopy to visualize MRS2 in its native membrane environment

  • NMR spectroscopy to study protein dynamics and ligand interactions

Structure-function relationships:

  • Site-directed mutagenesis guided by structural information to identify functional residues

  • Electrophysiological studies of mutated channels to correlate structure with transport properties

  • In silico molecular dynamics simulations to understand conformational changes during transport

Regulatory interactions:

  • Structural analysis of MRS2 in complex with regulatory proteins

  • Investigation of magnesium-dependent conformational changes

  • Assessment of post-translational modifications and their effects on protein structure

Comparative structural analysis:

  • Comparison with MRS2 homologs from other organisms to identify conserved structural features

  • Analysis of unique structural elements that might adapt the protein to A. gossypii's specific metabolic requirements

  • Evolutionary analysis to understand the adaptation of MRS2 structure to different cellular contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.