Recombinant Ashbya gossypii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TPC1; AAR036W; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TPC1
Target Protein Sequence
MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWA IAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY QRCLRLLEPTRAPQLPA
Uniprot No.

Target Background

Function
Mitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant A. gossypii TPC1?

For recombinant expression of A. gossypii TPC1, E. coli has been demonstrated as an effective heterologous host system . When expressing membrane proteins like TPC1, several methodological considerations should be addressed:

  • Vector selection: Vectors containing an N-terminal His tag facilitate easier purification while minimizing interference with protein function.

  • Expression conditions optimization: Temperature, induction timing, and inducer concentration should be optimized to prevent protein aggregation and inclusion body formation, which are common challenges with membrane proteins.

  • Cell lysis techniques: Gentle lysis methods are recommended to maintain protein structure, including sonication with detergent-containing buffers to solubilize membrane proteins.

  • Purification approach: Immobilized metal affinity chromatography (IMAC) using the His tag is typically performed, followed by size exclusion chromatography to increase purity.

For research requiring native conformation, eukaryotic expression systems might be considered as alternatives, though E. coli remains the most widely used system due to its simplicity and cost-effectiveness for initial characterization studies .

How should recombinant A. gossypii TPC1 be stored to maintain stability?

Optimal storage conditions for recombinant A. gossypii TPC1 require careful handling to maintain protein stability and activity. The following protocol is recommended:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Long-term storage: Store the protein at -20°C or preferably -80°C, with aliquoting being essential to avoid repeated freeze-thaw cycles that can degrade the protein .

  • Storage buffer composition: The protein is typically stored in a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose, which acts as a cryoprotectant .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

If activity loss is observed after storage, it may be necessary to optimize buffer conditions further by testing different pH values, salt concentrations, or alternative stabilizing agents specific to your experimental requirements.

What gene targeting strategies are effective for modifying TPC1 in A. gossypii?

A PCR-based one-step gene targeting approach has been established for A. gossypii, which can be efficiently applied to modify the TPC1 gene. This methodology has several advantages over traditional approaches:

  • Short homology requirement: Unlike many filamentous fungi, A. gossypii requires only short guide sequences (40-46 bp of homology) to mediate efficient homologous recombination .

  • Selection markers: Two primary selection systems have been validated:

    • G418/geneticin resistance using the GEN3 chimeric marker (E. coli kanR gene under S. cerevisiae TEF2 promoter control)

    • ClonNAT resistance using the NAT1 module

  • Primer design strategy:

    • For complete gene deletion: Design primers with 40-46 bp homology to sequences flanking the TPC1 open reading frame

    • For partial deletions or tagging: Target specific regions within the gene while maintaining reading frame integrity

  • Verification protocols:

    • PCR verification using gene-specific primers (e.g., TPC1-G1, TPC1-G4) combined with marker-specific primers

    • DNA hybridization analysis for confirmation of correct integration

This methodology allows for rapid genetic manipulation without the need to isolate and sequence large genomic fragments, making functional analysis more accessible. For TPC1 specifically, targeting the transmembrane domains could provide valuable insights into structure-function relationships of this carrier protein .

How can TPC1 function be assessed in the context of A. gossypii mitochondrial biology?

Evaluating TPC1 function in A. gossypii mitochondria requires a multifaceted approach, addressing both in vitro biochemical properties and in vivo physiological roles:

  • Transport assays:

    • Reconstitute purified TPC1 into liposomes

    • Measure thiamine pyrophosphate transport using radioactively labeled substrates

    • Determine kinetic parameters (Km, Vmax) under various conditions (pH, temperature, inhibitors)

  • Mitochondrial fractionation:

    • Isolate intact mitochondria from A. gossypii using differential centrifugation

    • Verify TPC1 localization using Western blotting with anti-His antibodies

    • Perform protease protection assays to confirm membrane topology

  • Genetic approaches:

    • Generate TPC1 deletion mutants using PCR-based gene targeting

    • Analyze phenotypic consequences in terms of:

      • Growth rate in different carbon sources

      • Mitochondrial morphology

      • Respiratory chain function

      • Metabolomic changes in thiamine-dependent pathways

  • Complementation studies:

    • Test whether TPC1 can functionally complement transporter defects in other systems (e.g., S. cerevisiae mutants)

    • Introduce point mutations in conserved residues to identify critical functional domains

When conducting these studies, it's important to consider that A. gossypii is multinucleated with asynchronous nuclear division , which may influence experimental design and data interpretation, particularly when studying mitochondrial-nuclear communication pathways.

What are the challenges in studying TPC1 interaction with the A. gossypii cell cycle and mitochondrial regulatory networks?

Investigating TPC1's potential role in cellular regulatory networks presents several methodological challenges:

  • Nuclear asynchrony considerations:

    • A. gossypii contains multiple nuclei that divide asynchronously

    • Mitoses commonly occur near cortical septin rings at growing tips and branchpoints

    • When designing experiments to study TPC1's influence on nuclear processes, spatial considerations within the hyphal cells become critical

  • Nutrient-responsive regulation:

    • A. gossypii exhibits distinct physiological responses to nutrient availability, with starvation triggering CDK phosphorylation via AgSwe1p

    • TPC1's role in thiamine pyrophosphate transport may intersect with these nutrient-sensing pathways

    • Experimental design should account for different nutrient conditions and potentially examine TPC1 expression patterns under starvation

  • Mitochondrial-nuclear signaling:

    • For co-localization studies with nuclear components, techniques must account for the multinucleated nature of A. gossypii

    • Approaches such as proximity labeling (BioID, APEX) could help identify TPC1's protein interaction network

    • When analyzing mitochondrial membrane proteins like TPC1, careful subcellular fractionation is required to distinguish true interactions from contamination

  • Technical approach for integration studies:

    • Combine metabolomic profiling of thiamine-dependent pathways with transcriptomic analysis

    • Use phosphoproteomics to identify potential TPC1-dependent signaling pathways

    • Consider mathematical modeling to understand the complex interplay between mitochondrial transport and cell cycle regulation

When conducting these studies, it's important to design appropriate controls that account for A. gossypii's unique cellular architecture and the potential pleiotropic effects of manipulating metabolite transporters .

How can aggregation issues be addressed when working with recombinant TPC1?

Membrane proteins like TPC1 are prone to aggregation during expression and purification. The following methodological approaches can help mitigate this challenge:

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Use specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Consider fusion partners that enhance solubility (e.g., MBP, SUMO)

  • Solubilization strategies:

    • Screen multiple detergents:

    Detergent ClassExamplesWorking ConcentrationNotes
    Non-ionicDDM, Triton X-1001-2%Milder, often preserve activity
    ZwitterionicLDAO, CHAPSO0.5-1%Intermediate stringency
    IonicSDS, Sarkosyl0.1-0.5%Harsh, may denature
    • Test mixed detergent systems (e.g., DDM/CHS combination)

    • Consider native nanodiscs or amphipols for detergent-free approaches

  • Buffer optimization:

    • Include stabilizing agents (glycerol, trehalose)

    • Test different pH ranges (typically 7.0-8.5)

    • Add specific cofactors (thiamine pyrophosphate may stabilize its carrier)

  • Purification adjustments:

    • Maintain detergent above critical micelle concentration throughout purification

    • Use size exclusion chromatography to remove aggregates

    • Consider on-column refolding for proteins recovered from inclusion bodies

For particularly challenging preparations, structural biology techniques like circular dichroism can help assess whether the purified protein maintains its secondary structure, providing confidence in subsequent functional studies .

What approaches can resolve inconsistent results in TPC1 functional assays?

When encountering variability in TPC1 functional assays, consider these methodological refinements:

  • Protein quality control:

    • Implement rigorous quality checks: SDS-PAGE, Western blot, and size exclusion chromatography profiles

    • Confirm protein homogeneity before functional assays

    • Establish batch-to-batch consistency metrics

  • Transport assay optimization:

    • Control liposome composition and size distribution (use dynamic light scattering)

    • Standardize protein-to-lipid ratios

    • Ensure complete reconstitution using protease protection assays

    • Include internal controls (known transporters with established activity)

  • Environmental variables management:

    • Temperature control during assay preparation and execution

    • Buffer composition consistency (particularly pH and ionic strength)

    • Minimize freeze-thaw cycles of reagents and protein samples

  • Data analysis refinement:

    • Apply appropriate normalization strategies

    • Use statistical methods suited for time-course transport data

    • Consider Michaelis-Menten kinetics for concentration-dependent studies

    • Implement blinded analysis to reduce experimental bias

  • Validation with orthogonal approaches:

    • Complement in vitro transport assays with in vivo functional studies

    • Use multiple substrate detection methods (radioactive, fluorescent, coupled enzymatic assays)

    • Develop genetic complementation systems in yeast or bacterial models

When troubleshooting, systematically modify one variable at a time while maintaining detailed records of all experimental conditions to identify the source of inconsistency.

How does A. gossypii TPC1 compare structurally and functionally to homologous proteins in other fungi?

A comparative analysis of A. gossypii TPC1 with homologous proteins reveals important evolutionary and functional relationships:

  • Sequence conservation patterns:

    • A. gossypii TPC1 shares significant homology with mitochondrial carriers in Saccharomyces cerevisiae, reflecting their close evolutionary relationship

    • Key structural features expected in all mitochondrial carrier family members include:

      • Three tandemly repeated ~100 amino acid domains

      • Conserved signature motif PX[D/E]XX[K/R]

      • Six transmembrane segments forming a barrel-like structure

  • Functional divergence assessment:

    • While core transport functions are likely conserved, regulatory elements may differ

    • A. gossypii's filamentous growth pattern versus S. cerevisiae's unicellular nature may influence:

      • Subcellular distribution patterns of mitochondria

      • Regulation of transporter activity in response to hyphal development

      • Integration with different nutrient sensing pathways

  • Comparative expression analysis:

    OrganismGrowth PatternMitochondrial DistributionTPC1 Regulation
    A. gossypiiFilamentousAlong hyphal lengthPotentially linked to branch formation
    S. cerevisiaeUnicellularEven distributionCell cycle regulated
    C. albicansDimorphicMorphology-dependentEnvironmental response linked
  • Structure-function relationship:

    • Homology modeling using solved structures of other mitochondrial carriers can predict:

      • Substrate binding residues

      • Conformational changes during transport

      • Potential regulatory interaction surfaces

This comparative approach can guide mutagenesis studies to identify residues that confer species-specific properties to TPC1, potentially revealing adaptation mechanisms in different fungal lifestyles .

What insights can be gained from studying TPC1 in relation to A. gossypii's unique multinucleated cellular organization?

A. gossypii's distinctive multinucleated architecture provides unique opportunities for studying mitochondrial transporters like TPC1:

  • Spatial regulation considerations:

    • Nuclei in A. gossypii divide asynchronously with mitoses concentrated near cortical septin rings at growing tips and branchpoints

    • This creates potential microenvironments within the same cytoplasm where:

      • Mitochondrial function may vary spatially

      • TPC1 activity might be differentially regulated

      • Metabolite gradients could form

  • Nutrient-responsive nuclear positioning:

    • A. gossypii exhibits starvation-induced CDK phosphorylation mediated by AgSwe1p, affecting nuclear density

    • TPC1's role in thiamine pyrophosphate transport may interact with these nutrient-sensing pathways

    • Research questions to explore:

      • Does TPC1 activity vary near actively dividing nuclei?

      • Can local thiamine pyrophosphate availability influence nuclear division?

      • How are mitochondria distributed in relation to nuclear position?

  • Methodological approaches:

    • Live-cell imaging with fluorescently tagged TPC1 and nuclei

    • Correlative light and electron microscopy to visualize mitochondrial morphology

    • Spatial metabolomics to map thiamine pyrophosphate distribution

    • Mathematical modeling of transport dynamics in the multinucleated context

  • Potential experimental design:

    • Generate TPC1 variants with altered transport kinetics

    • Examine effects on:

      • Nuclear division patterns (frequency, location)

      • Hyphal growth and branching

      • Response to nutrient limitation

    • Compare with septin mutants that show altered patterns of nuclear positioning

This research direction could reveal novel connections between mitochondrial transport, metabolism, and nuclear dynamics that might not be observable in unicellular models .

How might TPC1 function contribute to understanding metabolic adaptation in filamentous fungi?

TPC1's role in thiamine pyrophosphate transport positions it as a potentially crucial player in metabolic adaptation processes:

  • Thiamine-dependent metabolic networks:

    • Thiamine pyrophosphate (TPP) serves as an essential cofactor for key metabolic enzymes:

      • Pyruvate dehydrogenase complex

      • α-Ketoglutarate dehydrogenase

      • Transketolase

      • Branched-chain α-keto acid dehydrogenase

    • These enzymes function at critical junctions in:

      • Carbohydrate metabolism

      • Amino acid metabolism

      • Pentose phosphate pathway

  • Filamentous growth-specific considerations:

    • A. gossypii's filamentous growth pattern requires:

      • Polarized distribution of resources

      • Local metabolic adaptation at growing tips

      • Coordination of metabolism with nuclear division patterns

    • TPC1's potential role in supporting these processes through mitochondrial TPP transport

  • Nutrient sensing integration:

    • A. gossypii exhibits distinct responses to nutrient availability

    • Research questions to explore:

      • Does TPC1 expression or activity change under different nutrient conditions?

      • Can TPC1 manipulation affect the AgSwe1p-dependent starvation response?

      • Is mitochondrial TPP transport rate-limiting for growth under particular conditions?

  • Comparative metabolic analysis framework:

    Metabolic ProcessExpected Impact of TPC1 DysfunctionExperimental Approach
    TCA cycleReduced activity of α-KGDHIsotope tracing, metabolomics
    Glycolysis-TCA transitionImpaired PDH functionPyruvate utilization assays
    Pentose phosphate pathwayAltered transketolase activityNADPH/NADP+ ratio measurement
    Amino acid metabolismBranched-chain amino acid accumulationTargeted metabolomics

This research direction could establish TPC1 as a model for understanding how mitochondrial transporters contribute to the metabolic plasticity required for filamentous growth and adaptation to changing environments .

What potential roles might TPC1 play in biotechnological applications of A. gossypii?

A. gossypii has established biotechnological value, particularly as a riboflavin producer, and understanding TPC1 function could expand its applications:

  • Metabolic engineering opportunities:

    • TPP-dependent enzymes are critical in numerous biosynthetic pathways

    • Strategic TPC1 manipulation could:

      • Enhance flux through desired metabolic routes

      • Improve production of valuable compounds

      • Create new biosynthetic capabilities

  • Potential applications in bioproduct development:

    • A. gossypii is being explored as a platform for producing various compounds, including monoterpenes like sabinene

    • TPP-dependent enzymes participate in:

      • Isoprenoid precursor synthesis

      • Branched-chain alcohol production

      • Aromatic compound metabolism

  • Strain development strategies:

    • TPC1 overexpression could increase mitochondrial TPP availability

    • Protein engineering of TPC1 for altered transport kinetics

    • Co-expression with TPP-dependent enzymes for metabolic channeling

  • Integration with existing A. gossypii platforms:

    • Leverage established genetic tools including PCR-based gene targeting

    • Combine with regulation of nuclear division through AgSwe1p pathways

    • Develop synthetic biology modules incorporating TPC1 regulation

  • Experimental design framework:

    Engineering ApproachExpected OutcomeValidation Method
    TPC1 overexpressionIncreased mitochondrial TPPTPP transport assays
    TPC1 downregulationMetabolic shift to cytosolic pathwaysComparative metabolomics
    Conditional expressionTemporal control of TPP-dependent pathwaysInducible systems
    Localization engineeringAltered subcellular TPP distributionOrganelle-specific reporters

This research direction could establish TPC1 as a valuable target for expanding A. gossypii's biotechnological applications beyond its traditional use as a riboflavin producer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.