Recombinant Ashbya gossypii NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MCR1; ACR054C; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
MCR1
Target Protein Sequence
MLSRITRSSKALNFALGTTAVAAAGYLYAQSRGNLSTSLNKGDVTGQAAAQTFTGDGQWH ALKIAKIEQVSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVSDNMA RGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPL FQMMHHIAENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPEGDYK GEKGFITKDFLKQNLPTPGSNSHIFVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGYTK DHVYKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the role of NADH-cytochrome b5 reductase in Ashbya gossypii metabolism?

  • Mitochondrial respiratory chain function

  • Fatty acid metabolism

  • Sterol biosynthesis

  • Maintenance of cellular redox balance

The comprehensive genome-wide re-annotation of A. gossypii has improved our understanding of such metabolic functions, confirming its involvement in multiple redox-dependent pathways critical for this filamentous fungus .

How does A. gossypii MCR1 differ from its homologs in other fungal species?

A. gossypii MCR1 shares structural and functional similarities with homologs from related fungi, but with several key differences:

OrganismProtein NameSubcellular LocalizationKey Differences
A. gossypiiMCR1Mitochondrial outer membraneAdapted to filamentous growth metabolism
S. cerevisiaeMcr1Dual localization (outer membrane/intermembrane space)Processed to two different submitochondrial compartments
Neurospora crassamcr-1MitochondrialDifferent electron transfer properties

The metabolic re-annotation of A. gossypii revealed that despite high gene homology and gene order conservation with S. cerevisiae, A. gossypii shows distinct enzymatic functions across multiple metabolic pathways . These differences likely reflect adaptations to its filamentous growth pattern and specialized metabolism for riboflavin production.

What expression systems are suitable for producing recombinant A. gossypii MCR1?

Based on established protocols for recombinant protein production in A. gossypii, several expression systems have proven effective:

  • Homologous expression in A. gossypii:

    • Using native promoters like GPD1 that offer strong expression

    • Integration into the genome using CRISPR/Cas9 editing systems adapted for A. gossypii

    • Targeted integration at specific loci such as ADR304W and AGL034C using integrative cassettes

  • Heterologous expression systems:

    • Mammalian cell expression systems (as used for commercial production)

    • Yeast systems using strong constitutive promoters

When selecting an expression system, researchers should consider that A. gossypii itself has been evaluated as a host for recombinant protein production, showing variable secretion capacity that can be improved through random or direct mutagenesis approaches .

How can the CRISPR/Cas9 system be optimized for genetic manipulation of the MCR1 gene in A. gossypii?

The CRISPR/Cas9 system has been specifically adapted for A. gossypii genetic manipulation using a one-vector strategy that contains all necessary modules . For MCR1 gene editing, consider the following optimization approaches:

  • sgRNA design optimization:

    • Target the MCR1 gene with a 20 bp sequence complementary to the genomic target

    • Ensure the presence of a 5′-NGG-3′ PAM sequence

    • Position the sgRNA to avoid off-target effects

    • Use the promoter and terminator sequences from the A. gossypii SNR52 gene for sgRNA expression

  • Donor DNA design:

    • Create a mutagenic donor DNA (dDNA) with homology arms of 40-60 bp

    • For MCR1 functional studies, consider introducing specific point mutations rather than complete gene deletion

    • Include silent mutations in the PAM site to prevent re-cutting after repair

  • Delivery method optimization:

    • Transform spores of A. gossypii with the CRISPR construct

    • Select positive primary heterokaryotic clones using G418 resistance

    • Obtain homokaryotic clones through sporulation of primary transformants

This approach enables marker-free engineering strategies, facilitating precise modification of the MCR1 gene to study its functional importance in redox metabolism.

What methodologies are most effective for studying the subcellular localization and membrane topology of A. gossypii MCR1?

Based on studies of related membrane proteins, the following methodologies are particularly effective:

  • Protein purification and sequencing:

    • Perform subcellular fractionation to isolate mitochondrial outer membrane

    • Use hydropathy predictions combined with limited protease digestion to determine transmembrane segments

    • Analyze post-translational modifications that might affect localization

  • Fluorescent protein fusion constructs:

    • Create N- and C-terminal fusion proteins with GFP or other fluorescent markers

    • Use the Dual Luciferase Reporter assay adaptation for A. gossypii to assess expression levels

    • Verify correct genomic integration by analytical PCR and DNA sequencing

  • Immunolocalization techniques:

    • Generate specific antibodies against MCR1

    • Perform immunogold electron microscopy to visualize subcellular localization at high resolution

    • Use co-localization studies with known mitochondrial markers

  • Membrane topology analysis:

    • Apply the dense alignment surface (DAS) method to predict transmembrane domains

    • Use protease protection assays to determine which domains are exposed

    • Consider chemical labeling of accessible protein domains

These approaches can definitively establish the membrane topology and submitochondrial localization of MCR1, essential for understanding its function in electron transport chains.

How does oxygen limitation affect the expression and activity of MCR1 in A. gossypii?

The expression and activity of MCR1 in A. gossypii under oxygen-limited conditions involves complex regulatory mechanisms:

  • Transcriptional regulation:

    • Similar to other respiratory components, MCR1 expression likely increases under oxygen limitation as part of the cellular response to maintain redox balance

    • Promoter analysis using the adapted Dual Luciferase Reporter assay can quantify transcriptional changes under varying oxygen conditions

  • Functional importance in NADH reoxidation:

    • Under oxygen limitation, respiratory reoxidation of NADH becomes critical for maintaining cellular metabolism

    • MCR1 may contribute to alternative electron transport mechanisms that help reoxidize NADH under these conditions

    • The respiratory chain in A. gossypii differs from that in S. cerevisiae, particularly in NADH reoxidation pathways

  • Experimental methodology:

    • Conduct chemostat cultures under controlled oxygen availability

    • Monitor biomass-specific oxygen consumption rates

    • Measure respiratory quotient (RQ) values to assess metabolic shifts

    • Analyze MCR1 activity in relation to alternative NADH reoxidation mechanisms

Understanding these oxygen-dependent regulatory mechanisms is particularly relevant since A. gossypii is a filamentous fungus with high oxygen demand for riboflavin production and other metabolic processes.

What is the relationship between MCR1 function and riboflavin biosynthesis in A. gossypii?

A. gossypii is industrially important for riboflavin (vitamin B2) production , and MCR1 potentially influences this biosynthetic pathway:

  • Redox balance impact:

    • Riboflavin biosynthesis requires precise regulation of cellular redox state

    • MCR1's role in NADH oxidation likely contributes to maintaining optimal NAD+/NADH ratios for riboflavin production

    • Genome-wide metabolic re-annotation revealed connections between redox enzymes and riboflavin biosynthetic pathways

  • Metabolic pathway interactions:

    • Nitrogen metabolism, particularly glutamate and glycine metabolism, significantly impacts riboflavin biosynthesis

    • The absence of certain enzymes like alanine:glyoxylate aminotransferase (2.6.1.44) affects glycine formation, a precursor for riboflavin synthesis

    • MCR1 may indirectly influence these pathways through its effects on cellular redox state

  • Experimental approaches:

    • Generate MCR1 mutants using CRISPR/Cas9 and assess riboflavin production

    • Perform metabolic flux analysis to track carbon and nitrogen flow through related pathways

    • Conduct transcriptomic analysis under riboflavin-producing conditions to identify co-regulated genes

The intricate relationship between MCR1 function and riboflavin biosynthesis represents an important area for continued research with implications for improving industrial production.

What purification strategies yield the highest activity of recombinant A. gossypii MCR1?

Purification of recombinant A. gossypii MCR1 requires specialized approaches due to its membrane-associated nature:

  • Membrane protein solubilization:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for initial solubilization

    • Optimize detergent concentration to maintain protein structure and activity

    • Consider using amphipols or nanodiscs for maintaining native-like membrane environment

  • Chromatography techniques:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Ion exchange chromatography based on the protein's theoretical pI

    • Size exclusion chromatography as a final polishing step

  • Activity preservation strategies:

    • Include reducing agents (DTT, β-mercaptoethanol) throughout purification

    • Add NADH or FAD cofactors to stabilize the enzyme

    • Maintain low temperature (4°C) during all purification steps

    • Use glycerol (10-20%) in storage buffers to prevent activity loss

  • Quality control:

    • Verify purity by SDS-PAGE and Western blotting

    • Assess enzyme activity using cytochrome b5 reduction assays

    • Confirm protein identity through mass spectrometry

The purification approach should be tailored based on the expression system used, with mammalian cell-expressed MCR1 requiring different optimization than that expressed in fungal systems .

How can researchers accurately measure MCR1 enzymatic activity in experimental settings?

Accurate measurement of MCR1 enzymatic activity requires specialized assays:

  • Spectrophotometric assays:

    • Monitor NADH oxidation at 340 nm (ε = 6,220 M⁻¹ cm⁻¹)

    • Track cytochrome b5 reduction at 424 nm

    • Use ferricyanide as an artificial electron acceptor for high-throughput screening

  • Assay conditions optimization:

    ParameterOptimal RangeNotes
    pH6.5-7.5Buffer dependent
    Temperature25-30°CLower for stability studies
    NADH concentration50-200 μMAvoid substrate inhibition
    Cytochrome b51-10 μMUse recombinant cytochrome b5
    Ionic strength50-100 mMUsually KCl or NaCl
  • Controls and validations:

    • Include enzyme-free controls to account for non-enzymatic NADH oxidation

    • Validate with known inhibitors (e.g., p-hydroxymercuribenzoate)

    • Use purified S. cerevisiae Mcr1 as a reference standard

  • Advanced techniques:

    • Oxygen consumption measurements using Clark-type electrodes

    • Stopped-flow kinetics for rapid reaction analysis

    • Electron paramagnetic resonance (EPR) for redox center characterization

These methods enable accurate characterization of MCR1 enzymatic parameters including Km, Vmax, and substrate specificity, which are essential for understanding its physiological role.

What strategies can overcome expression and solubility challenges when working with recombinant A. gossypii MCR1?

Membrane proteins like MCR1 present significant expression and solubility challenges that can be addressed through:

  • Construct design optimization:

    • Create truncated versions excluding predicted transmembrane domains

    • Generate fusion proteins with solubility-enhancing tags (MBP, SUMO, Trx)

    • Optimize codon usage for expression host

    • Consider dual promoter systems for balanced expression of chaperones

  • Expression conditions modification:

    • Lower induction temperature (16-20°C) to slow folding and prevent aggregation

    • Use specialized media formulations with osmolytes like sorbitol or glycerol

    • Induce expression during late exponential phase

    • For A. gossypii expression, select carbon sources that enhance protein production

  • Solubilization enhancements:

    • Screen detergent panels (including non-ionic, zwitterionic, and steroid-based)

    • Apply random mutagenesis approaches to improve general secretion ability

    • Use chaperone co-expression systems to aid folding

  • Analytical approaches:

    • Apply small-scale expression tests before scaling up

    • Use GFP fusion reporters to monitor folding and solubility in real-time

    • Perform thermal shift assays to identify stabilizing buffer components

These strategies have been effective for improving expression of challenging membrane proteins from A. gossypii and related fungal species, as demonstrated by successful industrial enzyme production platforms .

How should researchers design experiments to study the physiological role of MCR1 in redox balance during A. gossypii development?

To study MCR1's role in redox balance during development:

  • Genetic manipulation approaches:

    • Generate conditional knockdown mutants using CRISPR/Cas9 technology

    • Create point mutations in critical functional domains

    • Develop fluorescent reporter systems for redox status monitoring

  • Developmental stage analysis:

    • Compare MCR1 expression and activity across key developmental transitions

    • Focus on sporulation events, which are affected by redox conditions

    • Examine the relationship between pH, RIM101 pathway, and MCR1 function during development

  • Metabolic analysis:

    • Measure NAD+/NADH ratios in different cellular compartments

    • Track changes in related metabolic pathways using metabolomics

    • Monitor oxygen consumption rates throughout development

  • Experimental design considerations:

    Developmental StageKey MeasurementsControl Comparisons
    Vegetative growthGrowth rate, hyphal morphologypH buffered conditions
    Early sporulationRedox enzyme activities, NAD+/NADH ratioWild-type vs. mutant
    Mature sporulationSpore viability, metabolite profilesOxygen-limited conditions
  • Integration with other pathways:

    • Analyze interactions with the RIM101 pathway, which affects sporulation at alkaline pH

    • Investigate connections to fatty acid metabolism and β-oxidation pathways

    • Examine relationships with riboflavin biosynthesis regulation

This comprehensive approach will provide insights into how MCR1 contributes to maintaining proper redox balance during the complex developmental program of this filamentous fungus.

What are common pitfalls in experimental design when studying A. gossypii MCR1, and how can they be avoided?

Researchers should be aware of these common pitfalls:

  • Genetic redundancy issues:

    • A. gossypii may contain multiple enzymes with overlapping functions to MCR1

    • Solution: Perform comprehensive homology searches and functional genomics to identify potential redundant genes

    • Consider creating multiple gene knockouts to overcome compensatory mechanisms

  • Growth condition variability:

    • A. gossypii exhibits strain heterogeneity and responds differently to carbon sources

    • Solution: Standardize growth media composition and environmental parameters

    • Include proper strain documentation and multiple biological replicates

    • Use chemically defined media rather than complex formulations

  • Subcellular fractionation contamination:

    • Mitochondrial preparations can be contaminated with other organelles

    • Solution: Verify fraction purity using marker proteins for different subcellular compartments

    • Use density gradient centrifugation for improved separation

    • Confirm results with complementary approaches like immunolocalization

  • Enzyme activity measurement artifacts:

    • Artificial electron acceptors may not reflect physiological activity

    • Solution: Compare results with multiple assay methods

    • Include appropriate controls for non-enzymatic reactions

    • Validate in vitro findings with in vivo approaches

By anticipating these challenges, researchers can design more robust experiments that yield more reliable and physiologically relevant data.

How can researchers distinguish between MCR1 isoforms and related NADH-cytochrome b5 reductases in complex biological samples?

Distinguishing between MCR1 isoforms and related enzymes requires:

  • Protein sequence analysis techniques:

    • Multiple sequence alignment to identify unique regions

    • Epitope mapping for antibody design targeting isoform-specific regions

    • Mass spectrometry with peptide fingerprinting for unambiguous identification

  • Immunological approaches:

    • Develop isoform-specific antibodies targeting unique epitopes

    • Use competitive binding assays to distinguish between related proteins

    • Apply immunoprecipitation followed by activity assays

  • Activity-based discrimination:

    • Analyze substrate preferences and kinetic parameters

    • Use selective inhibitors that differentially affect isoforms

    • Perform pH and temperature profiling to identify distinguishing characteristics

  • Genetic approaches:

    • Create tagged versions of each isoform for specific tracking

    • Generate knockout strains for individual isoforms to identify specific functions

    • Use RNA interference to selectively reduce expression of specific isoforms

These approaches allow researchers to overcome the challenges in distinguishing closely related enzymes, particularly important when studying the functional differences between multiple NADH-cytochrome b5 reductases that may be present in A. gossypii.

What statistical methods are most appropriate for analyzing variable MCR1 activity data across different experimental conditions?

For robust analysis of variable MCR1 activity data:

  • Descriptive statistics:

    • Report means with standard deviation or standard error

    • Use median and interquartile range for non-normally distributed data

    • Display data using box plots to visualize distribution characteristics

  • Inferential statistics:

    • Apply parametric tests (t-test, ANOVA) only after confirming normality

    • Use non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when appropriate

    • Conduct post-hoc tests with correction for multiple comparisons (Bonferroni, Tukey HSD)

  • Advanced statistical approaches:

    • Use mixed-effects models for experiments with multiple variables

    • Apply principal component analysis to identify patterns in complex datasets

    • Consider Bayesian statistics for small sample sizes with prior knowledge integration

  • Experimental design considerations:

    Experimental ScenarioRecommended AnalysisMinimum Sample Size
    Single factor, two conditionsPaired t-test or Wilcoxonn ≥ 6 per group
    Multiple conditionsOne-way ANOVA with post-hocn ≥ 5 per condition
    Multiple factorsTwo-way ANOVA or factorial designn ≥ 4 per combination
    Time courseRepeated measures ANOVAn ≥ 3 per time point
  • Reporting standards:

    • Include exact P-values rather than threshold reporting

    • Report effect sizes alongside significance values

    • Provide complete methodological details for reproducibility

These statistical approaches ensure rigorous analysis of MCR1 activity data, accounting for biological variability while maintaining scientific validity.

What emerging technologies might advance our understanding of A. gossypii MCR1 structure-function relationships?

Several cutting-edge technologies hold promise for elucidating MCR1 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane proteins in native-like environments

    • Visualization of MCR1 in different conformational states during catalysis

    • Structural insights into membrane integration and protein-protein interactions

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Advanced genome editing technologies:

    • Base editing for precise single nucleotide modifications without double-strand breaks

    • Prime editing for targeted insertions and deletions with minimal off-target effects

    • High-throughput CRISPR screening to systematically identify functional domains

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes during catalysis

    • Optical tweezers to investigate protein mechanics and folding

    • Single-molecule tracking in live cells to study dynamics and interactions

These technologies will provide unprecedented insights into how MCR1 structure relates to its function in electron transfer and redox metabolism, potentially opening new avenues for biotechnological applications.

How might systems biology approaches integrate MCR1 function into broader metabolic networks in A. gossypii?

Systems biology offers powerful frameworks to understand MCR1's role within the broader metabolic network:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map changes in MCR1 expression/activity to global metabolic shifts

    • Identify regulatory networks controlling MCR1 expression

  • Genome-scale metabolic modeling:

    • Incorporate MCR1 reactions into existing A. gossypii metabolic models

    • Perform flux balance analysis to predict effects of MCR1 perturbations

    • Use enzyme-constrained models to account for protein costs

  • Network analysis approaches:

    • Identify hub proteins and pathways connected to MCR1 function

    • Apply graph theory to map redox-dependent interaction networks

    • Conduct sensitivity analysis to identify critical nodes affecting riboflavin production

  • Experimental validation strategies:

    • Design targeted interventions based on model predictions

    • Validate in silico findings with experimental perturbations

    • Use isotope labeling experiments to track metabolic flux redistribution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.