Recombinant Ashbya gossypii Nuclear fusion protein KAR5 (KAR5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KAR5; ADR143W; Nuclear fusion protein KAR5; Karyogamy protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-478
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
KAR5
Target Protein Sequence
EITHVVSHLAETALRQDTNFQLLSQDIIAKKFPILDSSCVRRALSDFLPQCLQYGFETVP SDVRTQAAVKLSICELQASGVDNMPPECVGAVHFGACLRAMERTPQWWTTYSGNYQHLPS TCFENALPYEKEQLLSLFLNITDVYSNFQDDLVVDLEKYRANFEATVEASLRLMKASLME GTHEIVNQLKDDLNYVNSKLADMGKTITEHTDNVRTVFNDISDELNDYDMAGQIAHLKED TMSLWQKINSDMGTYRDVQMSSLYNINAVFDTFYNRATESVQQVRTSVIESQLETLDLIA DFNSLVRKSILPVLADELQPQLQEMSVSISRSLVGLSASYNEHLQAWSNRVNETLSEMES HLNNAMSQVEHMNDSIETLENKVFVLVSLGNALTTYVKWIYTFSRALISGYGIVTLIMSM LVVRYSIKLNSSWIKVLGRSTFILVAVVLGARTGSMLSY
Uniprot No.

Target Background

Function
Essential for nuclear membrane fusion during karyogamy.
Database Links
Protein Families
KAR5 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is the functional role of KAR5 in Ashbya gossypii?

KAR5 (Karyogamy protein 5) functions as a nuclear fusion protein in Ashbya gossypii, a filamentous ascomycete in the Saccharomycetaceae family. The protein plays a critical role in the nuclear membrane fusion process during sexual reproduction, particularly in the early stages of karyogamy. KAR5 is encoded by the KAR5 gene (locus ADR143W) and is essential for proper nuclear fusion during the sexual reproductive cycle . In the context of A. gossypii's life cycle, nuclear fusion events may occur during the transition from vegetative growth to sporulation, though the exact mechanisms differ from those in related yeasts like Saccharomyces cerevisiae.

How does A. gossypii KAR5 compare to its homologs in other fungi?

CharacteristicA. gossypii KAR5S. cerevisiae KAR5Functional Implications
Expression patternConstitutive with upregulation during sporulationInduced by pheromone signalingDifferent regulatory mechanisms
Protein sequence identityReference (Q759Y0)~60% identityConserved core function with species-specific adaptations
LocalizationNuclear envelopeNuclear envelopeConserved subcellular targeting
Reproductive contextHomothallic life cycleHeterothallic matingAdapted to different sexual reproduction strategies

Unlike S. cerevisiae, which requires mating between opposite mating types, A. gossypii is homothallic and can complete its life cycle starting from a single spore . This difference in reproductive strategy likely influences the regulation and function of KAR5.

What methodologies are optimal for studying KAR5 protein interactions?

The study of KAR5 protein-protein interactions requires specialized approaches due to its membrane-associated nature:

  • Yeast Two-Hybrid Modified for Membrane Proteins:

    • Use split-ubiquitin or membrane-based Y2H systems

    • Construct bait vectors containing soluble domains of KAR5

    • Screen against cDNA libraries from sporulating A. gossypii cells

  • Co-Immunoprecipitation with Membrane Solubilization:

    • Solubilize membranes using mild detergents (1% NP-40 or 1% Digitonin)

    • Use anti-KAR5 antibodies or tagged recombinant versions

    • Identify interaction partners through mass spectrometry

  • Proximity-Based Labeling:

    • Express KAR5 fused to BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify via mass spectrometry

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions with KAR5 and candidate interactors

    • Measure energy transfer in intact cells during nuclear fusion events

    • Quantify interaction dynamics during the fusion process

These methods should be tailored to the specific research question and combined for validation of results.

How can CRISPR-Cas9 gene editing be applied to study KAR5 function?

CRISPR-Cas9 offers powerful approaches for investigating KAR5 function in A. gossypii:

  • Domain-Specific Mutations:

    • Design sgRNAs targeting specific domains

    • Introduce precise mutations via homology-directed repair

    • Analyze phenotypic effects on nuclear fusion and sporulation

  • Fluorescent Tagging at Endogenous Locus:

    • Insert fluorescent protein tags at the N- or C-terminus

    • Maintain native promoter control

    • Track localization during nuclear fusion events

  • Conditional Allele Generation:

    • Introduce temperature-sensitive mutations

    • Create auxin-inducible degron tags for rapid protein depletion

    • Enable temporal control of KAR5 function

  • Promoter Replacement:

    • Substitute native promoter with controllable alternatives

    • Enable expression level manipulation

    • Study dosage effects on nuclear fusion efficiency

What is the relationship between KAR5 and sporulation efficiency in A. gossypii?

The relationship between KAR5 and sporulation in A. gossypii appears complex and interconnected with other regulatory pathways:

  • Genetic Interaction Network:
    While KAR5-specific data is limited, studies of related karyogamy genes provide insights. For example, deletion of KAR3 results in severely reduced sporulation, while KAR4 deletion abolishes sporulation entirely . This suggests KAR5 may have similar critical functions.

  • Regulatory Pathway Position:
    KAR5 likely functions downstream of primary sporulation regulators like IME1, IME2, and NDT80, which are essential for sporulation in A. gossypii . The expression of KAR5 may be regulated as part of the broader sporulation program.

  • MAP Kinase Signaling Influence:
    Components of MAP kinase cascades affect sporulation efficiency in A. gossypii. For example, deletion of STE11 and STE7 results in increased sporulation, while STE12 deletion causes oversporulation . These pathways may regulate KAR5 expression or activity.

What expression systems yield optimal recombinant KAR5 protein for structural studies?

Producing functional recombinant KAR5 requires careful consideration of expression systems:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effectiveMembrane protein folding challengesExpress soluble domains separately; use specialized strains (C41/C43)
Yeast (S. cerevisiae)Native-like post-translational modificationsLower yield than bacterial systemsUse strong inducible promoters; optimize codon usage
Insect cellsSuperior folding of complex proteinsHigher cost, longer production timeBaculovirus expression with optimized signal sequences
Cell-free systemsAvoids toxicity issuesExpensive, technically demandingSupplement with microsomes for membrane protein folding

For structural studies, expression of individual domains may be more successful than the full-length protein. Current commercially available recombinant KAR5 is supplied in a stabilizing buffer (Tris-based with 50% glycerol) , suggesting challenges in maintaining protein stability.

How does KAR5 contribute to the unique homothallic life cycle of A. gossypii?

A. gossypii exhibits a specialized form of homothallism that differs from S. cerevisiae:

  • A. gossypii can complete its life cycle starting from a single spore that forms a sporulating mycelium .

  • Unlike S. cerevisiae, A. gossypii does not encode an RME1 gene and harbors only MATa loci (no MATα) .

  • The process appears to involve homokaryotic haploid fruiting rather than traditional diploid meiosis .

In this context, KAR5 may function in:

  • Nuclear positioning and alignment within the mycelium

  • Fusion of genetically identical nuclei (rather than nuclei from opposite mating types)

  • Coordination of nuclear fusion with hyphal development and sporangia formation

Research by Wendland and colleagues suggests that while components of traditional mating pathways exist in A. gossypii, they have been repurposed to regulate sporulation rather than mating . KAR5 likely functions within this modified regulatory network.

What are the optimal storage and handling conditions for recombinant KAR5 protein?

For maintaining recombinant KAR5 protein stability and activity:

  • Storage Recommendations:

    • Store at -20°C for regular use

    • For extended storage, maintain at -80°C

    • Protein is typically supplied in Tris-based buffer with 50% glycerol

  • Handling Guidelines:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • If using for binding studies, ensure buffers contain stabilizing agents (glycerol, non-ionic detergents)

  • Activity Preservation:

    • Consider supplementing with protease inhibitors when working at higher temperatures

    • Maintain cold chain during experimental procedures

    • Validate protein folding state with circular dichroism before functional assays

How can immunodetection methods be optimized for KAR5 analysis?

Effective immunodetection of KAR5 requires consideration of its membrane-associated nature:

  • Western Blot Optimization:

    • Use membrane protein extraction buffers containing 1% Triton X-100 or similar detergents

    • Heat samples at 37°C rather than boiling to prevent aggregation

    • Run on gradient gels (4-12%) for better resolution

    • Transfer using lower voltage for extended time (15V overnight)

  • Immunofluorescence Protocol:

    • Fix cells with 4% paraformaldehyde followed by methanol permeabilization

    • Block with 5% BSA containing 0.1% saponin to maintain membrane structure

    • Use primary antibodies at 1:100-1:500 dilution in blocking buffer

    • Incubate overnight at 4°C for optimal penetration

  • Epitope Considerations:

    • Target antibodies to hydrophilic domains for better accessibility

    • Consider using tags (HA, FLAG, V5) inserted at hydrophilic loops for detection

    • Validate antibody specificity using knockout controls

What is the relationship between KAR5 and other karyogamy proteins in A. gossypii?

The functional relationship between KAR5 and other karyogamy proteins forms a complex network:

  • KAR3/KAR4 Interaction:
    Studies demonstrate that KAR3 deletion severely reduces sporulation, while KAR4 deletion abolishes it completely . These phenotypes suggest a coordinated function, with:

    • KAR3 (microtubule motor protein) likely mediating nuclear movement

    • KAR4 serving as a transcription factor that may regulate KAR5 expression

    • KAR5 potentially functioning downstream as the direct mediator of membrane fusion

  • Regulatory Hierarchy:
    The major regulators of sporulation in A. gossypii include IME1, IME2, IME4, and NDT80, deletion of which abolishes sporulation . This positions KAR5 as a potential downstream effector in the sporulation pathway.

  • Temporal Expression Patterns:
    RNA-seq profiling of sporulation-deficient mutants identified 67 downregulated genes that were upregulated in oversporulating mutants . Analysis of this dataset could reveal whether KAR5 is differentially expressed during sporulation.

How should researchers interpret KAR5 expression data in developmental studies?

When analyzing KAR5 expression data during A. gossypii development:

  • Normalization Considerations:

    • Use multiple reference genes for RT-qPCR (ACT1, TDH3, UBC6)

    • Account for changes in total RNA content during sporulation

    • Consider single-cell approaches as expression may vary within the mycelium

  • Developmental Timepoints:

    • Include at least 5 timepoints from vegetative growth through sporulation

    • Compare expression patterns with known sporulation markers (IME1, IME2, NDT80)

    • Correlate with microscopic observation of developmental stages

  • Interpretation Framework:

    • Distinguish between transcript and protein levels (post-transcriptional regulation)

    • Consider localization changes independent of expression changes

    • Analyze in context of MAP kinase pathway activation states

  • Statistical Analysis:

    • Use time-series statistical methods rather than simple pairwise comparisons

    • Account for biological variability between sporulation batches

    • Employ clustering with other developmentally regulated genes

What are the critical controls for KAR5 functional studies?

Robust KAR5 functional studies require multiple control experiments:

  • Genetic Controls:

    • Complete gene deletion (kar5Δ)

    • Point mutations in key domains

    • Complementation with wild-type KAR5

    • Heterologous complementation with S. cerevisiae KAR5

  • Specificity Controls:

    • Parallel analysis of related karyogamy mutants (kar3Δ, kar4Δ)

    • Analysis of upstream regulators (ime1Δ, ime2Δ)

    • Monitoring of other nuclear envelope proteins

  • Functional Validation Approaches:

    • Microscopic observation of nuclear fusion events using fluorescent nuclei

    • Quantification of sporulation efficiency

    • Assessment of spore viability and germination

  • Environmental Variables:

    • Test under different nutrient conditions

    • Vary temperature to identify conditional phenotypes

    • Assess response to osmotic and other stressors

What emerging technologies could advance KAR5 research?

Several cutting-edge approaches show promise for KAR5 functional studies:

  • Cryo-Electron Tomography:

    • Visualize nuclear membrane fusion intermediates at nanometer resolution

    • Localize KAR5 within the fusion machinery in situ

    • Identify structural rearrangements during the fusion process

  • Live-Cell Super-Resolution Microscopy:

    • Track KAR5 dynamics during nuclear fusion with 20-50nm resolution

    • Implement PALM/STORM or lattice light-sheet microscopy

    • Correlate protein dynamics with membrane fusion events

  • Proximity Proteomics with Temporal Resolution:

    • Apply TurboID or miniTurbo for rapid proximity labeling

    • Identify KAR5 interactors at different stages of nuclear fusion

    • Map the dynamic interactome during sporulation

  • AlphaFold2/RoseTTAFold Structure Prediction:

    • Generate structural models of KAR5 domains

    • Predict interaction interfaces with binding partners

    • Guide rational mutagenesis studies

These technologies could overcome current limitations in understanding the molecular mechanisms of KAR5-mediated nuclear fusion.

How might comparative studies across fungal species inform KAR5 function?

Cross-species analysis provides valuable evolutionary insights into KAR5 function:

  • Functional Conservation Assessment:

    • Test cross-complementation between A. gossypii and S. cerevisiae KAR5

    • Analyze hybrid proteins with domains swapped between species

    • Identify core conserved functions versus species-specific adaptations

  • Evolutionary Rate Analysis:

    • Compare substitution rates across homologs from multiple fungal species

    • Identify domains under purifying versus diversifying selection

    • Correlate evolutionary patterns with reproductive strategies

  • Species-Specific Regulation:

    • Compare promoter architecture and transcription factor binding sites

    • Analyze expression patterns in relation to life cycle differences

    • Identify regulatory rewiring associated with different reproductive modes

Studies in Candida glabrata have shown that replacing native IME1 and IME2 genes with S. cerevisiae orthologs enables complete sexual cycle in an otherwise asexual yeast . Similar approaches could reveal whether KAR5 functional differences contribute to the unique life cycle of A. gossypii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.