Recombinant Ashbya gossypii Palmitoyltransferase ERF2 (ERF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ERF2; AGL125C; Palmitoyltransferase ERF2; DHHC cysteine-rich domain-containing protein ERF2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
ERF2
Target Protein Sequence
MRLHSRQASNPHRQYSAAQSLHSSSDDSEHKEIPSTMGWAKRLMRWMVTVDQPHTFETSL KNYQSLAHVTNYIFFCGGRLRTVAKTKYLSVLVLVMLIAPIVLFSVFETGYLWKHVAGAK PCVVLCYYFWTLCFASFISTGATDPGTLPRNIHLAQLQDDYKLPLEYYSIITLPSPVANA PVRLKYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLS SIWLLTCCALKLRHAGSPSAAPVSLLLICYCAVSIWYPLLLAIYHLFLTGTQQTTHEYLK AVDSRNPIFHKVTHPERNPFVTGSCARNMLLLMCQPRGYDFLHTRSEHQAGDWRFFRLPI PHSFEKV
Uniprot No.

Target Background

Function
The ERF2-ERF4 complex is a palmitoyltransferase specific for Ras proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Palmitoyltransferase ERF2 in Ashbya gossypii?

Palmitoyltransferase ERF2 in Ashbya gossypii is an enzyme belonging to the protein acyltransferase family (EC 2.3.1.-) that contains a characteristic DHHC cysteine-rich domain. It functions as a Ras protein acyltransferase, catalyzing the addition of palmitate groups to specific protein substrates . The protein is encoded by the ERF2 gene located at the AGL125C locus in the A. gossypii genome and consists of 367 amino acids . This post-translational modification system is crucial for protein localization, stability, and signaling functions in cellular processes.

How does the structure of ERF2 relate to its function?

The ERF2 protein contains several key structural domains that determine its function:

  • DHHC cysteine-rich domain: The catalytic core responsible for palmitoyltransferase activity

  • Transmembrane regions: Several hydrophobic segments that anchor the protein to cellular membranes

  • Cytoplasmic domains: Regions that interact with substrate proteins and cofactors

The amino acid sequence reveals a complex protein structure with the characteristic DHHC domain embedded within a sequence containing multiple functional regions . The predicted membrane topology positions the DHHC domain toward the cytoplasmic side, allowing it to access substrate proteins and palmitoyl-CoA for catalysis. This structural arrangement facilitates ERF2's role in palmitoylating target proteins, particularly those involved in signal transduction pathways such as Ras proteins.

What experimental approaches are used to study ERF2 expression in A. gossypii?

Several experimental approaches can be employed to study ERF2 expression in A. gossypii:

  • Promoter analysis: The Dual Luciferase Reporter (DLR) Assay has been adapted for A. gossypii using integrative cassettes, allowing quantitative measurement of promoter activity . This system could be applied to study ERF2 promoter regulation.

  • Gene expression methods:

    • RNAseq for transcriptome-wide analysis of gene expression patterns

    • RT-qPCR for targeted quantification of ERF2 transcript levels

    • Northern blotting for detecting ERF2 mRNA

  • Protein detection methods:

    • Western blotting using antibodies against ERF2 or epitope tags

    • Fluorescent protein fusion for localization studies

    • Mass spectrometry for protein identification and quantification

  • Genetic manipulation approaches:

    • Gene deletion using marker systems like loxP-KanMX-loxP

    • Controlled expression using strong constitutive promoters (P₍GPD1), P₍CCW12), or P₍SED1))

    • Integration of expression cassettes at specific genomic loci (e.g., ADR304W, AGL034C)

These methods provide complementary information about ERF2 expression patterns, regulation, and function in A. gossypii.

What are the key properties of recombinant A. gossypii ERF2?

Recombinant A. gossypii Palmitoyltransferase ERF2 has several important properties that researchers should consider:

PropertySpecificationNotes
Protein length367 amino acids (full length)Covers expression region 1-367
Molecular weight~40-45 kDa (estimated)Based on amino acid sequence
Storage bufferTris-based buffer with 50% glycerolOptimized for protein stability
Storage temperature-20°C to -80°CFor extended storage
Working temperature4°CStable for up to one week
Catalytic activityPalmitoyltransferase (EC 2.3.1.-)DHHC-dependent acyltransferase
SubstratesRas proteins and potentially othersFunctions as a Ras acyltransferase
Affinity tagsVariableTag type determined during production

The recombinant protein typically requires proper handling to maintain its enzymatic activity, as repeated freeze-thaw cycles are not recommended .

What are the optimal storage and handling conditions for recombinant ERF2?

For maintaining optimal activity and stability of recombinant A. gossypii ERF2, the following storage and handling practices are recommended:

  • Long-term storage:

    • Store at -20°C for routine storage

    • Use -80°C for extended storage periods

    • Maintain in Tris-based buffer containing 50% glycerol as a cryoprotectant

  • Working conditions:

    • Keep working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles that can cause protein denaturation

    • Prepare small working aliquots to minimize exposure to freeze-thaw stress

  • Handling precautions:

    • Handle on ice when preparing reactions

    • Use low-binding microcentrifuge tubes to minimize protein loss

    • Add protease inhibitors if proteolytic degradation is a concern

    • Maintain reducing conditions to preserve DHHC domain functionality

These storage and handling conditions are essential for preserving the catalytic activity and structural integrity of recombinant ERF2 during experimental work.

How can researchers verify the quality of recombinant ERF2 preparations?

Verifying the quality of recombinant ERF2 preparations is crucial before proceeding with functional experiments. Several complementary approaches can be used:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining to evaluate protein homogeneity

    • Western blotting with anti-ERF2 antibodies or tag-specific antibodies

    • Size exclusion chromatography to detect aggregation or degradation products

    • Mass spectrometry for accurate mass determination and identification

  • Structural integrity verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Limited proteolysis to probe domain organization

  • Functional validation:

    • Enzymatic activity assays measuring palmitoylation of model substrates

    • Binding assays with known interaction partners

    • Thermal shift assays to assess proper folding and stability

  • Quality control parameters to document:

    • Protein concentration determination by multiple methods

    • Batch-to-batch consistency measurements

    • Storage duration and conditions prior to use

    • Number of freeze-thaw cycles experienced

Systematic quality verification ensures that experimental results with recombinant ERF2 are reliable and reproducible.

What are effective expression systems for producing recombinant A. gossypii ERF2?

Several expression systems can be used for producing recombinant A. gossypii ERF2, each with specific advantages:

Expression SystemAdvantagesConsiderationsOptimization Strategies
E. coliHigh yield, low cost, rapid productionMay lack proper PTMs, risk of inclusion bodiesUse specialized strains (C41/C43), fusion tags (MBP, SUMO), low temperature induction
S. cerevisiaeSimilar to native conditions, proper foldingModerate yield, longer production timeStrong promoters (GAL1), protease-deficient strains, optimized codons
P. pastorisHigh density culture, proper foldingInduction optimization neededMethanol induction protocol optimization, multi-copy integrants selection
A. gossypiiNative environment, authentic PTMsLower established yields, newer systemStrong promoters (P₍GPD1), P₍CCW12), P₍SED1)) , integration at specific loci (ADR304W, AGL034C)
Insect cellsEukaryotic PTMs, good for membrane proteinsHigher cost, complex methodologyOptimize viral titer, harvest timing, cell density

When expressing ERF2 in A. gossypii, researchers can utilize the new promoters identified for metabolic engineering of this organism, such as P₍GPD1) for strong constitutive expression . Integration of expression cassettes at specific genomic loci (ADR304W, AGL034C) has been validated using marker systems like loxP-KanMX-loxP with subsequent marker removal by Cre recombinase .

What methods are effective for measuring ERF2 enzymatic activity?

Several complementary methods can be employed to measure the palmitoyltransferase activity of ERF2:

  • Radioactive assays:

    • [³H]-palmitate or [¹⁴C]-palmitate incorporation into substrate proteins

    • Quantification by SDS-PAGE followed by fluorography or scintillation counting

    • Advantages: High sensitivity, direct measurement of palmitoylation

    • Limitations: Radioisotope handling requirements, disposal considerations

  • Click chemistry-based methods:

    • Use of alkyne-palmitate analogs that can be conjugated to detection tags

    • Visualization by fluorescence or biotin-streptavidin detection systems

    • Advantages: Non-radioactive, compatible with proteomics approaches

    • Sample quantification pipeline: Substrate protein → alkyne-palmitate labeling → click chemistry → detection → quantification

  • Acyl-biotin exchange (ABE) assay:

    • Hydroxylamine treatment to remove palmitate groups

    • Biotinylation of newly exposed thiols

    • Detection by streptavidin-based methods

    • Useful for detecting both in vitro and in vivo palmitoylation

  • Coupled enzyme assays:

    • Link palmitoylation to a detectable enzymatic reaction

    • Real-time monitoring of activity through spectrophotometric methods

    • Amenable to high-throughput screening formats

When measuring ERF2 activity, it's essential to include appropriate controls such as catalytically inactive mutants, no-enzyme controls, and substrate specificity controls to validate the results.

How can researchers identify and validate ERF2 substrates?

Identifying and validating ERF2 substrates requires a multi-faceted approach:

  • Candidate-based approaches:

    • Palmitoylation assays with putative substrates based on homology to known substrates

    • Mutagenesis of predicted palmitoylation sites followed by functional testing

    • Co-immunoprecipitation to detect physical interactions

  • Proteome-wide screening methods:

    • Palmitoyl-proteomics using click chemistry or ABE with mass spectrometry

    • Comparison of palmitoylated proteins in wild-type versus ERF2-deficient cells

    • Proximity labeling approaches (BioID, APEX) to identify proteins near ERF2

  • Validation strategies:

    • In vitro palmitoylation assays with purified components

    • Site-specific mutagenesis of predicted palmitoylation sites

    • Phenotypic rescue experiments with non-palmitoylatable mutants

    • Localization studies to assess membrane association changes

  • Bioinformatic approaches:

    • Prediction of palmitoylation sites using algorithms

    • Evolutionary conservation analysis of putative substrates

    • Structural modeling of substrate-enzyme interactions

The identification of ERF2 substrates in A. gossypii would provide valuable insights into its cellular functions, particularly in processes such as hyphal development and sporulation that are characteristic of this filamentous fungus .

How might ERF2 interact with signaling pathways in A. gossypii?

ERF2, as a palmitoyltransferase, likely influences multiple signaling pathways in A. gossypii:

  • MAP kinase signaling:

    • A. gossypii contains MAP kinase cascade components involved in sporulation

    • ERF2 may palmitoylate key proteins in this pathway to regulate their activity or localization

    • Palmitoylation could affect the assembly of signaling complexes at the membrane

  • G-protein signaling:

    • Components like Gpa1 and Ste4 have been studied in A. gossypii

    • Palmitoylation of G-protein subunits by ERF2 could regulate their membrane association

    • This modification might influence responses to external signals that trigger development

  • Nutrient sensing pathways:

    • Sporulation is often triggered by nutrient limitation

    • ERF2 might modify proteins involved in sensing nutrient availability

    • Palmitoylation could tune the sensitivity of these pathways to environmental changes

  • Stress response signaling:

    • A. gossypii must respond to various stresses during its lifecycle

    • ERF2-mediated palmitoylation might regulate stress response proteins

    • This could affect adaptation to unfavorable conditions that trigger sporulation

  • Transcriptional regulation:

    • Expression of sporulation genes requires coordinated transcriptional control

    • ERF2 might influence the activity of transcription factors like Ime1

    • Palmitoylation could affect nuclear localization or DNA binding properties

Experimental strategies to investigate these interactions could include genetic interaction studies, phosphorylation/palmitoylation crosstalk analysis, and signaling pathway activation assays in ERF2 mutant backgrounds.

How does ERF2 compare between A. gossypii and other fungal species?

Comparing ERF2 across fungal species provides insights into its evolutionary conservation and specialized functions:

AspectA. gossypii ERF2S. cerevisiae Erf2pOther Fungal Homologs
Protein structure367 amino acids, DHHC domain-containing Forms complex with Erf4pVariable complexity, conserved DHHC domain
Genomic contextLocated at AGL125C locus Present before whole genome duplicationSynteny patterns reflect evolutionary relationships
Substrate specificityPredicted Ras protein acyltransferase Palmitoylates Ras proteinsMay have species-specific targets
Functional rolesPotential roles in development, sporulationRegulates Ras localization and signalingVaries with morphological complexity
Cellular localizationMembrane-associated (predicted)ER and Golgi membranesGenerally membrane-associated

Notable considerations:

  • A. gossypii belongs to pre-whole genome duplication fungi but shares homologs of 95% of its genes with S. cerevisiae

  • The filamentous lifestyle of A. gossypii may require specialized functions of ERF2 compared to unicellular yeasts

  • A. gossypii is homothallic , potentially influencing the regulation of ERF2 in developmental processes

  • The relationship between ERF2 and the sporulation program might differ between A. gossypii and other fungi

Comparative genomic and functional studies would help elucidate the extent to which ERF2 functions are conserved versus specialized across fungal species.

How can ERF2 be targeted for metabolic engineering in A. gossypii?

A. gossypii is industrially important for riboflavin production, and ERF2 could be targeted for metabolic engineering applications:

  • Expression optimization strategies:

    • Integration of ERF2 expression cassettes at defined genomic loci (ADR304W, AGL034C)

    • Use of newly identified strong promoters (P₍GPD1), P₍CCW12), P₍SED1)) for optimal expression

    • Application of carbon source-regulatable promoters for controlled expression

    • Implementation of the loxP-KanMX-loxP marker system with Cre-mediated recycling for multiple modifications

  • Protein engineering approaches:

    • Modification of ERF2 substrate specificity to target specific metabolic enzymes

    • Creation of ERF2 variants with enhanced catalytic activity

    • Development of regulatable ERF2 variants responsive to specific signals

    • Design of synthetic protein palmitoylation circuits

  • Metabolic applications:

    • Regulation of key metabolic enzymes through targeted palmitoylation

    • Modification of membrane transporters to enhance precursor uptake or product export

    • Engineering of signal transduction pathways that control metabolism

    • Integration with dual reporter systems for monitoring metabolic states

  • Experimental validation:

    • Use of the Dual Luciferase Reporter Assay to validate ERF2-based regulatory systems

    • Implementation of stable genomic integration for consistent expression

    • Application of RNAseq for transcriptome-wide analysis of effects

These approaches could leverage ERF2 as a novel regulatory mechanism in metabolic engineering strategies for A. gossypii.

What techniques can be used to study ERF2 protein-protein interactions?

A comprehensive toolkit of methods is available for investigating ERF2 protein-protein interactions:

  • Affinity-based methods:

    • Co-immunoprecipitation (Co-IP) with antibodies against ERF2 or epitope tags

    • Tandem affinity purification (TAP) for isolation of ERF2 complexes

    • GST pull-down assays with recombinant proteins

    • Proximity-dependent biotin identification (BioID) to label proteins near ERF2

  • Genetic interaction approaches:

    • Yeast two-hybrid screens for binary interactions

    • Synthetic genetic array (SGA) analysis to identify functional relationships

    • Suppressor screens to identify genes that compensate for ERF2 mutations

    • Plasmid-based overexpression studies using pRS418-derived vectors

  • Imaging techniques:

    • Fluorescence resonance energy transfer (FRET) for detecting protein proximity

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions

    • Super-resolution microscopy to detect co-localization at high resolution

    • Live-cell imaging to track dynamic interactions

  • Mass spectrometry-based approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Quantitative proteomics to compare interactomes under different conditions

    • Thermal proximity co-aggregation (TPCA) to detect stable interactions

When designing protein interaction studies for ERF2, it's important to consider its membrane association and potentially transient interactions with substrate proteins.

How can researchers design experiments to elucidate ERF2 function in A. gossypii?

A systematic experimental approach to understand ERF2 function in A. gossypii would include:

  • Genetic manipulation strategies:

    • Generation of ERF2 deletion strains using the loxP-KanMX-loxP marker system

    • Creation of catalytically inactive mutants (e.g., DHHC to DHHA)

    • Development of conditionally expressed ERF2 using regulatable promoters

    • Complementation with ERF2 variants to determine functional domains

  • Phenotypic characterization methods:

    • Analysis of growth, morphology, and development in ERF2 mutants

    • Examination of sporulation efficiency and timing

    • Stress response profiling under various conditions

    • Ultrastructural analysis using electron microscopy

  • Molecular analysis approaches:

    • Transcriptome profiling (RNAseq) of wild-type versus ERF2 mutants

    • Proteome analysis focusing on palmitoylated proteins

    • Metabolite profiling to detect changes in primary and secondary metabolism

    • ChIP-seq to identify genes regulated by ERF2-affected transcription factors

  • Functional validation techniques:

    • In vitro reconstitution of ERF2-dependent palmitoylation

    • Cell biology assays to determine effects on protein localization

    • Signaling pathway activation studies in ERF2 mutant backgrounds

    • Complementation with homologs from other species to test functional conservation

  • Integration with existing A. gossypii research tools:

    • Application of dual luciferase reporter systems for gene expression analysis

    • Use of established genomic integration protocols

    • Leverage of sporulation analysis methods

    • Implementation of metabolic engineering frameworks

This multi-dimensional approach would provide comprehensive insights into ERF2 function in A. gossypii.

What are the current knowledge gaps in ERF2 research?

Despite the availability of recombinant A. gossypii ERF2 for research purposes, several significant knowledge gaps remain:

  • Substrate specificity: While ERF2 is described as a Ras protein acyltransferase , the complete spectrum of its physiological substrates in A. gossypii remains uncharacterized.

  • Developmental regulation: The potential role of ERF2 in A. gossypii's complex developmental processes, particularly sporulation , has not been specifically investigated.

  • Structure-function relationships: Detailed structural information about ERF2 and how it determines substrate recognition and catalytic efficiency is lacking.

  • Regulatory mechanisms: How ERF2 expression and activity are regulated in response to environmental conditions or developmental cues is poorly understood.

  • Metabolic integration: The connection between ERF2-mediated protein palmitoylation and A. gossypii's distinctive metabolism, including riboflavin production, remains unexplored.

Addressing these knowledge gaps will require integrated approaches combining genetics, biochemistry, cell biology, and systems-level analyses.

What future research directions could advance our understanding of ERF2 in A. gossypii?

Future research on ERF2 in A. gossypii could pursue several promising directions:

  • Systems biology approaches:

    • Comprehensive identification of the ERF2 "palmitoylome" in A. gossypii

    • Integration of transcriptomic, proteomic, and metabolomic data in ERF2 mutants

    • Network analysis to place ERF2 within regulatory frameworks

    • Modeling of ERF2's impact on cellular physiology and development

  • Applied biotechnology avenues:

    • Exploration of ERF2 as a target for metabolic engineering to enhance riboflavin production

    • Development of ERF2-based switches for controlling gene expression

    • Application of new A. gossypii promoters for optimized ERF2 expression

    • Creation of synthetic biology tools based on protein palmitoylation circuits

  • Evolutionary and comparative studies:

    • Analysis of ERF2 function across the fungal kingdom

    • Investigation of how ERF2 contributes to A. gossypii's filamentous lifestyle

    • Comparison with other DHHC proteins in A. gossypii and related species

    • Exploration of ERF2's role in the homothallic lifecycle of A. gossypii

  • Technological innovations:

    • Development of ERF2-specific small molecule modulators

    • Creation of biosensors for monitoring protein palmitoylation in vivo

    • Application of CRISPR-Cas9 for precise genome editing of ERF2

    • Implementation of advanced imaging techniques to visualize ERF2 activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.