Recombinant Ashbya gossypii Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ashbya gossypii Palmitoyltransferase PFA4 (PFA4)

Recombinant Ashbya gossypii Palmitoyltransferase PFA4 (PFA4) is a heterologously expressed enzyme involved in protein palmitoylation, a post-translational modification critical for membrane localization and signaling. This enzyme belongs to the protein S-acyltransferase (PAT) family and is homologous to fungal PATs responsible for attaching palmitoyl groups to target proteins.

Recombinant Expression Systems

While Ashbya gossypii PFA4 is primarily expressed in E. coli ( ), homologs from other fungi (e.g., Cryptococcus neoformans, Candida glabrata) are produced in diverse systems:

OrganismHost SystemPurityGene ID
Ashbya gossypiiE. coli>90%ACL003C
Cryptococcus neoformansE. coli/Yeast≥85%CNB04690
Candida glabrataE. coli/Yeast≥85%CAGL0E02497g
Gibberella zeaeCell-free expression≥85%FGSG_01411

Catalytic Activity and Substrate Specificity

  • Enzyme Class: EC 2.3.1.- (protein acyltransferases).

  • Function: Transfers palmitoyl groups to cysteine residues on target proteins, modulating membrane association.

  • Applications:

    • Research: Studying palmitoylation in fungal pathogens (e.g., Cryptococcus).

    • Biotechnology: Potential use in engineered lipid metabolism pathways (e.g., lipid biosynthesis in Ashbya gossypii) .

Comparative Analysis of Fungal PFA4 Homologs

FeatureAshbya gossypii PFA4Cryptococcus neoformans PFA4
LengthFull-length (375 aa)Partial or full-length
Expression HostE. coliE. coli/Yeast
Purity>90%≥85%
TagN-terminal His-tagVaries (His-tag common)

Industrial and Academic Uses

  • Recombinant Protein Production: Utilized in structural studies or enzymatic assays for palmitoylation.

  • Lipid Engineering: Potential integration into engineered pathways for biofuel or lipid-derived compound synthesis .

  • Pathogen Research: Homologs in Cryptococcus and Candida may inform antifungal strategies targeting palmitoylation .

Challenges and Future Directions

  • Functional Characterization: Limited experimental data on Ashbya gossypii PFA4’s in vivo substrates or regulatory mechanisms.

  • Scalability: Optimization of E. coli expression systems to improve yield or stability.

  • Synergy with Other Pathways: Investigating cross-talk between PFA4, fatty acyl-CoA synthetases (e.g., AgFAA1), and desaturases (e.g., AgOLE1) in lipid metabolism .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
PFA4; ACL003C; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
PFA4
Target Protein Sequence
MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWYND WGESLEHFGVDVEVE
Uniprot No.

Target Background

Function
Mediates the reversible addition of palmitate to target proteins, thereby regulating their membrane association and biological function.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Palmitoyltransferase PFA4 in Ashbya gossypii?

Palmitoyltransferase PFA4 (also known as Protein S-acyltransferase or Protein fatty acyltransferase 4) is an enzyme found in the filamentous fungus Ashbya gossypii. It belongs to the family of palmitoyltransferases that catalyze the addition of palmitate to specific proteins through a process called S-acylation or palmitoylation. The gene encoding this protein is designated as ACL003C in A. gossypii's genome . This post-translational modification is critical for various cellular processes including protein trafficking, stability, and function.

What expression systems are typically used for producing Recombinant A. gossypii PFA4?

For laboratory research, Escherichia coli is commonly used as an expression system for producing recombinant A. gossypii PFA4. The protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography techniques . While E. coli is the predominant expression system mentioned in the literature for this protein, the choice of expression system can vary depending on the specific research objectives and desired post-translational modifications.

How should Recombinant A. gossypii PFA4 be stored and reconstituted for experimental use?

For optimal stability and activity, Recombinant A. gossypii PFA4 should be stored following these guidelines:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
FormLyophilized powder

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Create working aliquots to minimize freeze-thaw cycles, which can degrade the protein

What experimental design approaches are most effective for studying PFA4 function?

When designing experiments to study PFA4 function, researchers should implement true experimental designs that include:

  • Control vs. Experimental Groups: Clearly defined control groups and experimental groups with systematic manipulation of independent variables.

  • Variable Identification and Control:

    • Independent variables: May include PFA4 concentration, substrate availability, or environmental conditions

    • Dependent variables: Typically enzymatic activity, substrate modification levels, or cellular phenotypes

    • Extraneous variables: Must be identified and controlled to avoid confounding results

  • Randomization: Proper randomization is essential to distribute unknown variables evenly across experimental groups, ensuring that observed effects can be attributed to the manipulated variables rather than to pre-existing differences .

  • Hypothesis Formulation:

    • Null hypothesis (H₀): "There is no effect of [specific condition] on PFA4 activity"

    • Alternative hypothesis (H₁): "Treatment with [specific condition] significantly alters PFA4 activity"

These principles ensure that the experimental results on PFA4 function can establish valid cause-effect relationships.

How can mutagenesis approaches be used to enhance the expression or activity of A. gossypii PFA4?

Mutagenesis strategies can be applied to enhance PFA4 expression or activity through both random and targeted approaches:

Random Mutagenesis:

Ethyl methane sulfonate (EMS) has been successfully used for random mutagenesis in A. gossypii. This approach can generate mutants with improved protein secretion capabilities. For example, in related studies with A. gossypii:

MutantImprovement in Enzymatic Activity
S4361.4-2 fold increase across multiple enzymes
S3972-fold increase in specific enzymes
B3903-fold increase in specific activities
S4662-fold improvements in selected enzymes

The S436 mutant demonstrated a global improvement in protein secretion, which could be relevant for enhancing PFA4 production .

Directed Mutagenesis:

For PFA4-specific modifications, targeted approaches should focus on:

  • Modifying key catalytic residues within the DHHC domain

  • Altering membrane-spanning regions for improved localization

  • Engineering the substrate-binding pocket for modified specificity

  • Optimizing signal sequences for enhanced secretion

When applying these approaches to PFA4, researchers should design experiments with appropriate controls and measurement techniques to accurately assess the impact of mutations on enzyme activity and stability.

What analytical techniques are most suitable for characterizing PFA4 enzyme kinetics?

For rigorous characterization of PFA4 enzyme kinetics, a combination of techniques is recommended:

  • In vitro Palmitoylation Assays:

    • Using purified recombinant PFA4 and fluorescently labeled substrate peptides

    • Measuring palmitoyl-CoA incorporation rates under varying substrate concentrations

    • Determining Km, Vmax, and catalytic efficiency (kcat/Km)

  • Experimental Design Considerations:

    • Control Group: Reactions with heat-inactivated enzyme or catalytically inactive mutants

    • Independent Variables: Substrate concentration, cofactor levels, pH, temperature

    • Dependent Variable: Rate of palmitoylation

  • Data Analysis Framework:

    • Michaelis-Menten kinetics model application

    • Lineweaver-Burk plots for determining kinetic parameters

    • Statistical analysis to validate significance of observed differences

  • Complementary Approaches:

    • Metabolic labeling with palmitate analogs

    • Mass spectrometry for identifying palmitoylated substrates

    • Structural analysis techniques (X-ray crystallography, cryo-EM) for substrate-enzyme interaction studies

These analytical approaches should be implemented within a properly controlled experimental design to ensure reliable and reproducible characterization of PFA4 enzymatic properties.

How does A. gossypii PFA4 compare functionally to homologous proteins in other fungal species?

When comparing A. gossypii PFA4 to homologous proteins in other fungi, researchers should implement comparative experimental designs that control for species-specific variables:

  • Sequence and Structural Comparison:

    • Alignment of the 375-amino acid sequence of A. gossypii PFA4 with homologs

    • Conservation analysis of the DHHC catalytic domain and membrane topology

    • Phylogenetic analysis to establish evolutionary relationships

  • Functional Conservation Experiments:

    • Cross-species complementation assays

    • Substrate specificity profiling across fungal homologs

    • Localization studies to determine subcellular distribution patterns

  • Experimental Design Requirements:

    • Controls: Expression level normalization across species

    • Variables: Species-specific substrates, growth conditions, cellular contexts

    • Measurement: Standardized activity assays to allow direct comparison

In studies with S. cerevisiae homologs of A. gossypii proteins, researchers have successfully used complementation approaches to determine functional conservation across species . Similar methodologies can be applied to PFA4 to establish the degree of functional homology and species-specific adaptations.

What are the critical quality control parameters for ensuring recombinant PFA4 functionality?

To ensure the functionality of recombinant A. gossypii PFA4 protein preparations, several quality control parameters must be monitored:

ParameterAcceptable CriteriaMethodology
Purity>90%SDS-PAGE analysis
IdentityMatches expected MWMass spectrometry verification
SolubilityNo visible aggregationVisual inspection and dynamic light scattering
Enzymatic ActivityConsistent specific activityPalmitoylation assay with standard substrate
Tag IntegrityDetectable His-tagWestern blot or affinity binding tests

Additionally, researchers should verify protein stability after reconstitution and storage by periodically measuring enzymatic activity. Avoiding repeated freeze-thaw cycles is critical, as they can significantly impact protein functionality .

How can researchers optimize experimental design when studying PFA4 interactions with potential substrate proteins?

When investigating PFA4 interactions with substrate proteins, a systematic experimental design approach should include:

  • Hypothesis Development:

    • Clearly articulate the expected interaction between PFA4 and potential substrates

    • Formulate testable predictions regarding the nature and consequences of these interactions

  • Variable Control Strategy:

    • Independent Variables: PFA4 concentration, substrate variants, cofactors

    • Dependent Variables: Binding affinity, palmitoylation efficiency, functional outcomes

    • Control Variables: pH, temperature, buffer composition, presence of competing proteins

  • Experimental Techniques:

    • Co-immunoprecipitation with tagged PFA4

    • Biolayer interferometry or surface plasmon resonance for binding kinetics

    • Click chemistry approaches to identify palmitoylated substrates

    • Split-reporter assays for in vivo interaction detection

  • Validation Approaches:

    • Multiple complementary techniques to confirm interactions

    • Mutational analysis of key residues in both PFA4 and substrates

    • Functional assays to determine the biological significance of the interaction

  • Data Analysis Framework:

    • Statistical testing for significance (e.g., t-tests, ANOVA)

    • Curve fitting for binding kinetics

    • Network analysis for multiple substrate interactions

By implementing this structured experimental design approach, researchers can obtain reliable and reproducible data on PFA4-substrate interactions while minimizing the influence of confounding variables.

What are the current research gaps regarding A. gossypii PFA4 that future studies should address?

Based on the current literature, several research gaps concerning A. gossypii PFA4 warrant further investigation:

  • Substrate Specificity Profile: A comprehensive characterization of the natural substrates of PFA4 in A. gossypii is lacking. Future studies should employ proteomics approaches to identify the complete set of proteins modified by PFA4.

  • Regulatory Mechanisms: The factors that regulate PFA4 activity in response to cellular conditions remain poorly understood. Research into post-translational modifications of PFA4 itself and their impact on enzymatic activity would provide valuable insights.

  • Structural Characterization: High-resolution structural data for A. gossypii PFA4 is currently unavailable. Structural studies would enhance our understanding of substrate recognition and catalytic mechanisms.

  • Biotechnological Applications: The potential applications of PFA4 in protein engineering or as a target for antifungal development remain underexplored. Studies investigating these possibilities could open new research avenues.

  • Improved Mutagenesis Approaches: Building on the success of random mutagenesis in enhancing protein secretion in A. gossypii , targeted approaches specifically optimized for PFA4 could yield proteins with enhanced properties for research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.