Recombinant Ashbya gossypii Palmitoyltransferase PFA5 (PFA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will then fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please specify it to us, and we will prioritize developing it accordingly.
Synonyms
PFA5; ABR203W; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
PFA5
Target Protein Sequence
MWQCKNKSRWWYSLVPILCICIMCYGAIAYSYSFCYVEVWTHLGMKAAAIGMTCLHLIIV ILLWIIWAQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAATSVLPPDVYQCDTQGYPV WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIF VSVVSLQRRIASSARMRGEREDPNVLVVLSLSCLVLLMVGALFISFLNYMANNQTTIEKL DTPKRQPRTMCFCVYNPADQYRYVVKSLPHENWNMWDKGSAYANYKDFLGSSIWRWFIPI GSNIPEFQTSAWEDDYNAILGPYKEELGSHYRDILMQRIEQGKYVTRLRVYGDKFREGL
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family, PFA5 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it suitable for expressing recombinant proteins like PFA5?

Ashbya gossypii is a filamentous ascomycete fungus primarily known for its industrial application in riboflavin (vitamin B2) production. It offers several advantages as an expression system for recombinant proteins, including PFA5. The organism has been extensively characterized at the genomic level, showing evolutionary relationships with Saccharomyces cerevisiae while exhibiting filamentous growth characteristics .

A. gossypii is amenable to functional genome analysis through gene targeting methods and can utilize autonomously replicating plasmids, making it highly suitable for genetic manipulation . The fungus also has a well-characterized secretory pathway, with recent studies providing detailed insights into its secretome and transcriptional responses to protein secretion stress . These characteristics make A. gossypii particularly valuable for expressing complex proteins like palmitoyltransferases that require post-translational modifications and proper membrane integration.

Furthermore, industrial strains of A. gossypii have demonstrated high protein production capacities, with studies reporting riboflavin production levels of up to 8.12 g/L under optimized conditions . This production capacity can be leveraged for recombinant protein expression, including membrane-associated enzymes like PFA5.

What expression vectors and promoters are most effective for recombinant PFA5 expression in A. gossypii?

For optimal expression of recombinant proteins like PFA5 in A. gossypii, researchers should consider both the vector design and promoter selection carefully. Integration-based expression systems are preferable to episomal vectors, as plasmids show limited stability in the multinucleated syncytium of A. gossypii . Integrative cassettes designed for site-specific recombination provide more consistent expression levels and greater experimental reproducibility.

Recent research has significantly expanded the promoter options available for A. gossypii expression systems. The TEF promoter is frequently used due to its strong constitutive expression properties, with EGI expression under this promoter serving as a reference in comparative studies . The Dual Luciferase Reporter (DLR) assay has been adapted for A. gossypii, allowing quantitative assessment of promoter strength through sequential measurement of Renilla and firefly luciferase activities .

For membrane proteins like palmitoyltransferases, moderately strong promoters are often preferable to prevent overwhelming the secretory pathway and triggering unfolded protein response. Carbon source-regulatable promoters are particularly valuable for expression of potentially toxic proteins, enabling precise control over expression timing and intensity .

How should growth conditions be optimized for maximum recombinant PFA5 expression in A. gossypii?

Optimizing growth conditions for recombinant protein expression in A. gossypii requires careful consideration of several parameters. Studies have shown that A. gossypii can produce 5.7 ± 0.2 g/L dry biomass in defined minimal medium (DMM) and 8.1 ± 0.3 g/L in rich medium (AFM) with sucrose as the primary carbon source . For membrane proteins like PFA5, balancing growth rate with protein expression is particularly important.

pH control significantly impacts protein production in A. gossypii. Research has demonstrated that maintaining pH in the range of 6.0-7.0 using KH₂PO₄ buffer during late growth phase can increase production yields by approximately 27% . For recombinant PFA5 expression, similar pH control strategies should be evaluated to determine the optimal conditions.

Medium composition also plays a crucial role. While rich media (AFM) supports higher biomass production, defined minimal media may offer advantages for specific recombinant proteins by reducing the background protein content in the secretome. In complex media, A. gossypii secretes a greater diversity of proteins (182 protein spots detected) compared to minimal media (157 protein spots) .

What strategies can address secretion stress when expressing recombinant PFA5 in A. gossypii?

Managing secretion stress is crucial when expressing membrane proteins like PFA5 in A. gossypii. Interestingly, transcriptomic analyses of A. gossypii under secretion stress conditions reveal that, unlike many fungi, it does not activate a conventional unfolded protein response (UPR). Expression levels of typical UPR target genes (IRE1, KAR2, HAC1, and PDI1 homologs) remain unaffected during dithiothreitol (DTT)-induced stress .

Instead, A. gossypii employs alternative mechanisms to cope with secretion stress. Under DTT treatment, genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, vesicle trafficking, vacuolar protein sorting, and mRNA degradation are upregulated . Researchers should consider co-expressing these stress-response factors when producing recombinant PFA5.

Glycosylation pathway components are severely repressed during secretion stress in A. gossypii . For palmitoyltransferases that may require specific glycosylation patterns, careful monitoring and potential engineering of the glycosylation machinery might be necessary to maintain proper protein function.

A time-course analysis approach is recommended to identify the optimal expression window. DTT exposure reduces growth rate in A. gossypii, with concurrent downregulation of genes involved in filamentous growth, glycosylation, lipoprotein biosynthesis, and cell wall biosynthesis within 30 minutes of treatment . Similar patterns may occur during strong overexpression of membrane proteins like PFA5.

How can the actin cytoskeleton influence membrane protein localization and function of recombinant PFA5 in A. gossypii?

The actin cytoskeleton plays a fundamental role in protein trafficking and localization in A. gossypii, which is particularly relevant for membrane proteins like palmitoyltransferases. Research on A. gossypii formins, especially AgBni1p, has demonstrated their essential nature in hyphal development through organization of actin cables .

Formins nucleate actin cables that serve as tracks for vesicle transport to hyphal tips. AgBni1p localizes to hyphal tips and is essential for the organization of actin cables and tip-directed transport of secretory vesicles . Disruption of actin cable formation in AgBni1p mutants results in expansion to potato-shaped giant cells lacking proper vesicle transport . For recombinant PFA5 that requires proper membrane targeting, the integrity of these actin-dependent transport systems is crucial.

The activity of AgBni1p is regulated by Rho-type GTPases through its diaphanous autoregulatory domain (DAD) . Constitutively active AgBni1p leads to premature tip splitting, likely triggered by AgCdc42p-GTP . Researchers expressing membrane proteins like PFA5 should consider how alterations in these pathways might affect protein localization and function.

For optimal localization studies of membrane-associated palmitoyltransferases, GFP-tagging strategies similar to those used for AgSpa2p can be employed . Such approaches allow visualization of protein distribution during the dynamic processes of hyphal growth and tip splitting, providing insights into the spatial regulation of enzymatic activity.

What methods are most effective for assessing enzymatic activity of recombinant PFA5 in A. gossypii?

Assessing the enzymatic activity of recombinant palmitoyltransferases like PFA5 in A. gossypii requires specialized approaches that account for the membrane-associated nature of these enzymes. A combination of in vitro and in vivo methods is recommended for comprehensive characterization.

In vitro activity assays:

  • Membrane fraction isolation through ultracentrifugation (100,000×g) from A. gossypii mycelia

  • Detergent solubilization optimization using a panel of non-ionic and zwitterionic detergents

  • Enzymatic assays using radiolabeled palmitoyl-CoA to track transfer to substrate proteins

  • Mass spectrometry-based detection of palmitoylated peptides to identify specific modification sites

In vivo activity assessment:

  • Metabolic labeling with alkyne-palmitate analogs combined with click chemistry for visualization

  • Phenotypic rescue experiments in PFA5-deficient strains to confirm functional complementation

  • Fluorescence microscopy to track substrate localization changes dependent on PFA5 activity

  • Acyl-biotinyl exchange chemistry to quantify global changes in protein palmitoylation levels

For high-throughput screening of PFA5 variants, adaptation of the Dual Luciferase Reporter system described for promoter analysis could be repurposed . By designing substrate-reporter fusion constructs whose localization (and thus activity) depends on palmitoylation, relative enzymatic efficiency could be measured in living cells.

How can mutagenesis approaches be used to improve recombinant PFA5 stability and activity in A. gossypii?

Strategic mutagenesis can significantly enhance recombinant PFA5 stability and activity in A. gossypii. Drawing parallels from successful mutagenesis approaches used for riboflavin production improvement provides valuable insights .

Ultraviolet irradiation has proven effective for generating A. gossypii mutants with enhanced production capabilities. Studies showed that 10 minutes of UV exposure resulted in a 5.5% spore survival rate, with 10% of survivors developing into overproducing mutants . Similar approaches could be applied to strains expressing recombinant PFA5 to select for variants with improved expression or stability.

Site-directed mutagenesis targeting key regulatory domains of PFA5 could enhance enzyme performance. Modification of transmembrane domains, DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) catalytic regions, or protein interaction interfaces may yield variants with altered substrate specificity or increased catalytic efficiency.

The table below summarizes potential mutagenesis approaches and their applications for PFA5 optimization:

Mutagenesis MethodTarget RegionExpected OutcomeAnalysis Method
UV irradiationWhole genomeRandom mutations affecting expressionProduction level screening
Error-prone PCRPFA5 coding sequenceCatalytic variants with altered activityEnzymatic assay
Site-directed mutagenesisDHHC-CRD domainModified substrate specificityMS-based substrate profiling
Domain swappingTransmembrane regionsAltered membrane localizationFluorescence microscopy
N-/C-terminal truncationsRegulatory domainsEnhanced stability/reduced degradationWestern blot analysis

For each mutagenesis approach, integration of the modified gene at the native locus using the gene targeting methods established for A. gossypii is recommended to ensure physiological expression levels .

What are the key considerations for scaling up recombinant PFA5 production in A. gossypii for structural studies?

Scaling up recombinant PFA5 production in A. gossypii for structural studies presents unique challenges that require careful optimization. Membrane proteins like palmitoyltransferases are particularly difficult to produce in quantities sufficient for structural analysis.

Bioreactor cultivation strategies:
Adapting the optimization approaches used for riboflavin production provides a framework for PFA5 scale-up. Dynamic analysis of growth phase parameters allows precise control of cultivation conditions . Maintaining pH in the 6.0-7.0 range during later growth phases can significantly enhance protein production, as demonstrated for riboflavin where yields increased from 6.38 g/L to 8.12 g/L with proper pH control .

Expression system considerations:
For structural studies requiring isotopic labeling, defined minimal media (DMM) is preferable to rich media (AFM) . While biomass yields may be lower (5.7 g/L versus 8.1 g/L), the controlled media composition facilitates incorporation of labeled precursors and simplifies downstream purification.

Membrane protein extraction optimization:
The hyphal structure of A. gossypii presents challenges for cell disruption and membrane protein extraction. Mechanical disruption methods like homogenization or bead-beating are recommended, with careful buffer optimization to maintain PFA5 stability.

Purification strategy:
Two-dimensional gel electrophoresis analysis of A. gossypii secreted proteins reveals that most have isoelectric points between 4 and 6, and molecular weights above 25 kDa . This information should guide purification strategy development for recombinant PFA5, with particular attention to detergent selection for membrane protein solubilization.

Structural integrity verification:
Before committing to large-scale structural studies, small-scale expression trials with activity assays and thermostability assessments should be conducted. Circular dichroism spectroscopy and limited proteolysis can provide valuable information about the folding quality of the recombinant protein.

How can researchers overcome poor expression levels of recombinant PFA5 in A. gossypii?

Poor expression of recombinant PFA5 in A. gossypii can stem from multiple factors. A systematic troubleshooting approach addressing transcription, translation, and post-translational processes is recommended.

At the transcriptional level, promoter choice is critical. While the TEF promoter is commonly used for heterologous expression in A. gossypii, it may not be optimal for all proteins . The recently developed Dual Luciferase Reporter Assay allows screening of alternative promoters with varying strengths and regulatory properties . For membrane proteins like PFA5, moderately strong promoters often yield better results than very strong promoters that can overwhelm the secretory pathway.

Codon optimization can significantly impact translation efficiency. A. gossypii has a genomic GC content of approximately 52%, which differs from that of other organisms . Adapting the PFA5 coding sequence to A. gossypii codon preferences can enhance translation efficiency without altering the amino acid sequence.

For membrane proteins, co-expression of chaperones can improve folding and stability. While A. gossypii does not exhibit a conventional unfolded protein response, it does upregulate specific factors during secretion stress . Co-expression of these factors, particularly those involved in protein folding and ER-associated degradation, may enhance functional PFA5 production.

What approaches can address improper localization of recombinant PFA5 in A. gossypii?

Improper localization of recombinant PFA5 in A. gossypii can significantly impact its functionality. Several strategies can help ensure correct membrane targeting and distribution.

Signal sequence optimization is essential for proper entry into the secretory pathway. Analysis of native A. gossypii membrane proteins can identify efficient signal sequences that facilitate correct membrane integration. For palmitoyltransferases like PFA5, preserving the native transmembrane domains is critical for proper orientation in the membrane.

The actin cytoskeleton plays a crucial role in protein trafficking in A. gossypii. The formin AgBni1p is essential for organizing actin cables that serve as tracks for vesicle transport . Ensuring the integrity of this transport system through appropriate growth conditions and avoiding cytoskeleton-disrupting agents is important for proper PFA5 localization.

Fluorescent protein tagging permits direct visualization of localization patterns. GFP-tagging strategies similar to those used for AgSpa2p can be adapted for PFA5 . When designing fusion constructs, the tag position should be carefully considered to avoid disrupting membrane integration or enzymatic activity.

The table below summarizes methods for assessing and troubleshooting PFA5 localization:

Localization Analysis MethodInformation ProvidedTroubleshooting Approach
Fluorescence microscopySubcellular distribution patternOptimize signal sequence/transmembrane domains
Subcellular fractionationQuantitative distribution in cellular compartmentsAdjust expression conditions to reduce aggregation
Protease protection assayMembrane topology confirmationModify transmembrane domain boundaries
Bimolecular fluorescence complementationInteraction with known binding partnersCo-express interaction partners to stabilize localization
Immuno-electron microscopyHigh-resolution localizationFine-tune expression level to avoid saturation effects

How can researchers differentiate between native and recombinant PFA5 activity in A. gossypii?

Distinguishing between native and recombinant PFA5 activity in A. gossypii requires careful experimental design and multiple complementary approaches.

Epitope tagging of the recombinant PFA5 allows selective immunoprecipitation and activity measurement. Small epitope tags like FLAG or HA can be incorporated at positions that don't interfere with enzymatic function, enabling specific isolation of the recombinant enzyme for activity assays.

Selective mutagenesis of catalytic residues in the recombinant PFA5 can create variants with altered substrate specificity. By engineering the recombinant enzyme to modify substrates not targeted by the native enzyme, researchers can specifically monitor recombinant PFA5 activity even in the presence of the endogenous enzyme.

Gene knockout/complementation approaches provide definitive evidence of recombinant PFA5 functionality. Using the gene targeting methods established for A. gossypii , researchers can delete the native PFA5 gene and then complement with the recombinant version, allowing clear assessment of the recombinant enzyme's activity without background from the native protein.

Quantitative mass spectrometry using stable isotope labeling can differentially track palmitoylation by native versus recombinant enzymes. By incorporating isotope-labeled palmitate precursors during expression of the recombinant enzyme, modified substrates can be distinguished based on the mass shift of the attached palmitate.

How might genome-scale metabolic modeling improve recombinant PFA5 production in A. gossypii?

Genome-scale metabolic modeling offers powerful approaches for optimizing recombinant protein production in A. gossypii. For complex membrane proteins like PFA5, systematic modeling of cellular resources can identify key bottlenecks and intervention points.

Flux balance analysis (FBA) can predict how redirecting carbon flux might improve precursor availability for protein synthesis and post-translational modifications. For palmitoyltransferases, ensuring adequate supply of palmitoyl-CoA without disrupting membrane lipid homeostasis is particularly important.

Integration of transcriptomic data from secretion stress experiments with metabolic models can identify non-intuitive engineering targets. While A. gossypii does not exhibit a conventional unfolded protein response, it does show specific transcriptional changes during secretion stress that could inform metabolic engineering strategies.

Dynamic modeling of growth phase transitions can optimize the timing of recombinant protein expression. A. gossypii undergoes significant metabolic shifts during its lifecycle, from isotropic growth to hyphal development and tip splitting . Synchronizing recombinant PFA5 expression with the metabolic state most conducive to membrane protein production could significantly improve yields.

Comparative genomic approaches leveraging the evolutionary relationship between A. gossypii and S. cerevisiae can identify conserved and divergent metabolic pathways . This information can guide rational engineering of A. gossypii metabolism to better support recombinant membrane protein production.

What potential applications exist for engineered variants of recombinant PFA5 from A. gossypii?

Engineered variants of recombinant PFA5 from A. gossypii have potential applications across multiple research and biotechnology domains.

In fundamental research, PFA5 variants with altered substrate specificity can serve as tools for investigating the role of protein palmitoylation in cellular processes. By creating PFA5 enzymes that selectively modify specific proteins, researchers can dissect the functional consequences of palmitoylation on individual substrates.

For biotechnology applications, engineered PFA5 enzymes could enable site-specific modification of proteins with various lipid moieties. By altering the acyl-CoA specificity of PFA5, researchers could create enzymes capable of transferring non-native lipid groups, expanding the toolkit for protein engineering.

In pharmaceutical research, PFA5 variants could facilitate the development of lipid-modified peptide therapeutics. Many peptide drugs benefit from lipid modification to improve pharmacokinetics and membrane permeability. Engineered PFA5 enzymes could provide enzymatic routes to such modifications under mild conditions.

Biosensor development represents another promising application. PFA5 variants designed to recognize specific protein sequences could be coupled with fluorescent reporters to create sensors for monitoring protein-protein interactions or conformational changes in living cells.

The table below summarizes potential engineering targets and applications for PFA5 variants:

Engineering TargetModification ApproachPotential Application
Substrate recognitionMutation of binding pocket residuesSelective palmitoylation of target proteins
Acyl-CoA specificityAlteration of catalytic siteTransfer of non-native lipid moieties
ThermostabilityConsensus design/directed evolutionImproved enzyme performance in industrial settings
Allosteric regulationEngineering regulatory domainsCreating switchable enzymes responsive to specific signals
Subcellular targetingAddition of localization sequencesCompartment-specific protein modification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.