Recombinant Ashbya gossypii pH-response regulator protein palI/RIM9 (RIM9)

Shipped with Ice Packs
In Stock

Description

Functional Role in pH Regulation and Secretion

RIM9 is implicated in pH-responsive signaling and protein secretion pathways in A. gossypii:

  • pH Regulation: Acts as a pH-response regulator, potentially modulating fungal adaptation to environmental pH changes .

  • Secretome Contribution: A. gossypii secretes 1–4% of its proteome, with secreted proteins typically having pI values of 4–6 and molecular masses >25 kDa .

  • Stress Response: Under secretion stress (e.g., dithiothreitol treatment), genes involved in ER-associated degradation and vesicle trafficking are upregulated, though the canonical unfolded protein response (UPR) pathway remains inactive .

Key Uses in Biotechnology

  • Recombinant Protein Studies: Used to investigate fungal secretion mechanisms and optimize industrial protein production .

  • ELISA and Assays: Commercial kits employ recombinant RIM9 for antibody validation and functional studies .

  • Comparative Genomics: Orthologs of RIM9 exist in Saccharomyces cerevisiae, Yarrowia lipolytica, and other fungi, aiding evolutionary studies .

Transcriptomic Insights

A 2014 study analyzed A. gossypii under recombinant protein secretion stress:

Gene CategoryExpression TrendExample Genes
Protein secretionUpregulatedVesicle trafficking, ERAD components
Glycosylation pathwayDownregulatedGlycosyltransferases, chaperones
UPR markersUnchangedIRE1, KAR2, HAC1

Orthologs and Evolutionary Conservation

RIM9 homologs are widespread in fungi, with functional conservation in pH regulation:

SpeciesGene/ProteinFunction
Saccharomyces cerevisiaeRIM9pH sensing, sporulation
Yarrowia lipolyticaYALI0_E33627gSecretion stress response
Magnaporthe oryzaeMGCH7_ch7g355Pathogenicity regulation

Research Gaps and Future Directions

  • Mechanistic Insights: The exact role of RIM9 in pH sensing remains uncharacterized.

  • Industrial Optimization: Engineering A. gossypii strains with enhanced RIM9 activity could improve recombinant protein yields .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For convenient reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your specific requirements.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to ensure optimal protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is typically determined during production, we are open to incorporating specific tag types upon request. Please let us know your desired tag type, and we will strive to fulfill your requirement preferentially.
Synonyms
RIM9; ADR141W; pH-response regulator protein palI/RIM9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
RIM9
Target Protein Sequence
MMGGMSVVEWLLLGSTTLALLFQSFATFSVPLSNGVTLSHFNGYKFGVFGWCDTTHTHCT PLKLGYSAEDGFLFAGQDELSLPTQAKYSLSKLLVVHPLALCSMVVLWLMVVLSQCYKHS DRRLTIIILWSFLTYMETLLCFLVDVLLFVPYLDWPGWLMLVSAVLVVFSSSIACLRRRT LTSQRIEKGAKEDLELYPLYGGALGAGVVSDSESPHRPYTEGSIISVTSRASSRLLPSAS ELETPREELTLMDPSIKCHIERSPMS
Uniprot No.

Target Background

Function
This protein is essential for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH. Its role is crucial in regulating cellular response to environmental pH changes.
Database Links
Protein Families
PalI/RIM9 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it significant as a research model?

Ashbya gossypii is a riboflavin-overproducing filamentous fungus that shares a close evolutionary relationship with unicellular yeasts such as Saccharomyces cerevisiae. Its significance as a research model stems from several key characteristics. First, A. gossypii exhibits filamentous growth patterns while maintaining genetic similarity to unicellular yeasts, with approximately 95% of its genes having homologs in S. cerevisiae . This unique position makes it an excellent model for studying the regulatory networks governing morphological differences between filamentous and yeast-like growth.

The completion of the A. gossypii genome sequence has further enhanced its utility as a research model, allowing for comprehensive genetic manipulation and comparative genomic analyses. Additionally, the insights gained from studying A. gossypii can be applied to understand related dimorphic yeasts, including the human fungal pathogen Candida albicans, where morphological switching is critical for virulence . This translational potential makes A. gossypii research particularly valuable for both fundamental mycology and medical applications.

What is the function of the RIM9 protein in Ashbya gossypii?

The RIM9 protein (also annotated as pH-response regulator protein palI/RIM9) functions as a component of the pH-sensing pathway in A. gossypii. Based on its homology to similar proteins in related fungi, RIM9 likely plays a crucial role in the RIM101 pathway, which is responsible for mediating cellular responses to environmental pH changes . This conserved signaling pathway enables the fungus to adapt to fluctuations in external pH conditions by modulating gene expression patterns.

In the context of A. gossypii biology, the RIM9 protein appears to be particularly important for growth and developmental processes that are pH-dependent, such as sporulation. The full-length protein consists of 266 amino acids and contains structural elements typical of membrane-associated pH sensors . While specific biochemical functions of RIM9 have not been fully characterized in A. gossypii, studies of the RIM101 pathway suggest RIM9 likely participates in signal transduction cascades that ultimately influence transcription factors controlling pH-responsive genes .

How does the RIM101 pathway function in pH regulation in fungi?

The RIM101 pathway represents a conserved signaling mechanism that enables fungi to respond to changes in environmental pH. This pathway has been extensively studied in model organisms like Aspergillus nidulans (where the ortholog is called PacC) and Saccharomyces cerevisiae. In A. gossypii, the RIM101 pathway functions similarly to these related fungi, with several key components that enable pH sensing and response .

The pathway is typically activated under alkaline conditions. In A. nidulans, PacC acts as both an activator of alkaline-expressed genes and a repressor of acid-controlled genes through binding to the consensus sequence GCCARG . In S. cerevisiae, the RIM101 ortholog regulates the expression of IME1 (Initiator of MEiosis), which is essential for sporulation processes .

Research has demonstrated that in A. gossypii, the RIM101 pathway is crucial for both growth and sporulation at alkaline pH, with deletion mutants showing significant defects in these processes when exposed to alkaline conditions. Interestingly, A. gossypii rim101 mutants can still sporulate under acidic conditions, suggesting that RIM101-mediated signaling is specifically required for responding to alkaline environments rather than being universally necessary for sporulation .

What experimental approaches are recommended for reconstituting recombinant RIM9 protein?

When working with recombinant A. gossypii RIM9 protein, proper reconstitution is critical for maintaining protein structure and function. Based on established protocols, the following methodology is recommended:

  • Initial Preparation: Briefly centrifuge the vial containing lyophilized RIM9 protein to ensure all content is at the bottom before opening .

  • Reconstitution Solution: Use deionized sterile water for protein reconstitution, aiming for a final concentration between 0.1-1.0 mg/mL .

  • Glycerol Addition: For long-term storage, add glycerol to a final concentration of 5-50%. The standard recommendation is 50% glycerol to prevent protein denaturation during freeze-thaw cycles .

  • Aliquoting: Divide the reconstituted protein into small working aliquots to minimize repeated freezing and thawing, which can compromise protein integrity .

  • Storage Conditions: Store working aliquots at 4°C for up to one week for immediate use. For longer-term storage, maintain aliquots at -20°C or preferably -80°C .

This reconstitution approach helps maintain the structural integrity and functional properties of the recombinant RIM9 protein for subsequent experimental applications.

What are the optimal conditions for storing recombinant RIM9 protein?

The proper storage of recombinant RIM9 protein is essential for maintaining its stability and biological activity. Based on manufacturer recommendations and general protein handling practices, the following storage conditions are optimal:

  • Short-term Storage: For active ongoing experiments, store working aliquots at 4°C for no longer than one week .

  • Long-term Storage: Maintain stock solutions at -20°C or preferably -80°C to minimize protein degradation .

  • Storage Buffer: The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

  • Avoiding Freeze-Thaw Cycles: Repeated freezing and thawing should be strictly avoided as this can lead to protein denaturation and loss of activity .

  • Aliquoting Strategy: Upon initial reconstitution, divide the protein solution into small single-use aliquots to prevent the need for multiple freeze-thaw cycles .

  • Glycerol Addition: Including glycerol at a final concentration of 50% provides cryoprotection and helps preserve protein structure during freezing .

Adherence to these storage guidelines will maximize the shelf-life and experimental utility of recombinant RIM9 protein preparations.

How does RIM101 influence sporulation in Ashbya gossypii at different pH levels?

The influence of RIM101 on sporulation in A. gossypii exhibits a striking pH-dependent pattern. Research demonstrates that RIM101 is essential specifically for sporulation under alkaline conditions, while being dispensable for sporulation in acidic environments .

This suggests that RIM101 may play a dual role in A. gossypii: directly regulating sporulation genes and facilitating pH homeostasis to create favorable conditions for sporulation. This differs somewhat from S. cerevisiae, where RIM101 is universally required for sporulation, highlighting interesting evolutionary adaptations in pH-responsive developmental pathways .

What methodological approaches are recommended for generating Agrim101 deletion strains?

For researchers investigating the function of RIM101 in A. gossypii, generating deletion strains requires specific methodological considerations. Based on successful protocols reported in the literature, the following approach is recommended:

  • PCR-Based Gene Targeting: Utilize the PCR-based gene-targeting approach, which has proven highly efficient for generating deletion mutants in A. gossypii . This method involves:

    • Amplifying gene deletion cassettes from plasmids like pFA-GEN3 using gene-specific S1- and S2-primers

    • Designing primers with 45 bp homology to regions flanking the target gene

    • Introducing a selectable marker (typically G418/geneticin resistance) within the deletion cassette

  • Transformation Protocol: Transform A. gossypii using electroporation as described in established protocols . The transformation conditions typically include:

    • Preparing competent cells from young mycelium

    • Electroporation with optimal voltage and capacitance settings

    • Selection with G418/geneticin at 200 μg/mL

  • Verification Strategy: Confirm successful deletion through diagnostic PCR using:

    • Primers that anneal outside the integration site and within the selection marker

    • Verification of both the absence of the target gene and correct integration of the deletion cassette

  • Isolation of Homokaryotic Strains: A. gossypii transformants are initially heterokaryotic (containing both wild-type and transformed nuclei). To obtain homokaryotic deletion strains:

    • Allow heterokaryotic transformants to sporulate

    • Select spores on G418-containing media to isolate homokaryotic mutants

    • Verify homokaryotic status through additional diagnostic PCR

  • Phenotypic Validation: Confirm the phenotypic effects of the deletion by comparing:

    • Vegetative growth rates on standard and pH-buffered media

    • Sporulation efficiency at different pH values

    • pH modulation capability in liquid culture

This comprehensive approach ensures the generation of reliable deletion strains for investigating RIM101 function in A. gossypii.

How can researchers effectively analyze sporulation efficiency in Agrim101 mutants?

Analyzing sporulation efficiency in A. gossypii rim101 mutants presents unique methodological challenges due to the filamentous growth pattern and spore characteristics of this fungus. Based on established research protocols, the following comprehensive approach is recommended:

Solid Media Sporulation Analysis:

  • Grow wild-type and rim101 mutant strains on full media plates buffered to various pH values (6.5-8.5) for 10 days at 30°C .

  • Isolate spores from the central sporulation zone (15 mm diameter) using zymolyase treatment (10 mg/mL) in TE buffer for 3 hours at 37°C to degrade vegetative hyphal cells .

  • Collect spores by centrifugation and wash twice with spore buffer (0.03% Triton-X-100) to remove cellular debris .

  • Prepare serial dilutions and plate on full media to determine colony-forming units (CFUs) .

Liquid Media Sporulation Assessment:

  • Pre-culture strains in full medium (AFM) before transferring equal amounts of mycelia to minimal sporulation medium with defined pH .

  • Incubate cultures for one week at 28°C to allow complete sporulation .

  • Examine sporulation microscopically, identifying spore clusters and quantifying sporulation efficiency .

  • Measure pH changes in the medium to correlate pH modulation with sporulation capability .

Important Methodological Considerations:

  • A. gossypii spores tend to agglomerate due to their hydrophobicity and terminal filaments, making single-spore suspensions difficult to obtain .

  • CFU counts typically represent clumps of spores rather than individual spores, so consistent handling is essential for comparative analyses .

  • Include pH measurements before and after sporulation to assess the strain's ability to modulate environmental pH, which correlates strongly with sporulation efficiency .

  • For accurate comparison, always analyze multiple independent deletion strains to confirm phenotypic consistency and rule out secondary mutations .

This multifaceted approach provides a comprehensive assessment of sporulation efficiency while accounting for the unique biological characteristics of A. gossypii.

What are the key considerations when designing experiments to study RIM9 function in relation to the RIM101 pathway?

When designing experiments to investigate RIM9 function within the RIM101 pathway in A. gossypii, researchers should consider several critical factors that will influence experimental outcomes and data interpretation:

1. Genetic Interaction Analysis:

  • Generate single and double deletion mutants of RIM9 and other components of the RIM101 pathway (such as RIM13/ADR274C and RIM20/AER342C) to assess epistatic relationships .

  • Compare phenotypes of rim9 and rim101 mutants to determine if RIM9 functions exclusively within the RIM101 pathway or has independent roles.

2. pH Control and Monitoring:

  • Implement rigorous pH control using appropriate buffers (such as Tris-HCl) to maintain stable pH conditions throughout experiments .

  • Monitor pH changes during growth and development, as A. gossypii can actively modify environmental pH .

  • Design experiments across a pH gradient (pH 6.5-8.5) to capture the full spectrum of pH-dependent phenotypes .

3. Developmental Stage-Specific Analysis:

  • Differentiate between effects on vegetative growth versus sporulation, as these processes may have distinct pH dependencies .

  • Implement time-course experiments to capture transitional states between growth and sporulation.

4. Protein Localization and Dynamics:

  • Generate fluorescently tagged RIM9 constructs to monitor subcellular localization under different pH conditions.

  • Use time-lapse microscopy to track dynamic changes in RIM9 localization during pH shifts.

  • Consider the implications of the RIM9 protein structure, including its 266 amino acid sequence with potential transmembrane domains, when designing fusion proteins .

5. Transcriptional Profiling:

  • Perform RNA-seq analysis comparing wild-type and rim9 mutants under different pH conditions to identify RIM9-dependent gene expression patterns.

  • Focus analysis on genes known to be involved in sporulation and pH response.

6. Comparative Analysis with Model Yeasts:

  • Leverage the close relationship between A. gossypii and S. cerevisiae to design comparative experiments that highlight conserved and divergent functions .

  • Consider complementation experiments to test functional conservation of RIM9 across species.

7. Physical Interaction Studies:

  • Use recombinant His-tagged RIM9 protein for pull-down assays to identify interaction partners .

  • Consider the native buffer conditions (Tris/PBS-based buffer, pH 8.0) when designing interaction studies to maintain protein functionality .

These considerations will help researchers design robust experiments that elucidate the specific role of RIM9 in the pH-response pathway of A. gossypii while accounting for the unique biological characteristics of this filamentous fungus.

How can researchers interpret contradictory data regarding RIM9 function in different experimental conditions?

When faced with contradictory data regarding RIM9 function across different experimental conditions, researchers should implement a systematic analytical approach that considers multiple factors affecting experimental outcomes:

1. pH Measurement Verification:

2. Strain Background Considerations:

  • Verify genetic homogeneity of experimental strains through resequencing or extensive genotyping.

  • Consider potential secondary mutations that may have arisen during transformation or propagation.

  • Compare multiple independent mutant isolates to rule out strain-specific artifacts .

3. Developmental Stage Analysis:

  • Precisely define developmental stages being analyzed, as RIM9 function may vary between vegetative growth and sporulation phases .

  • Implement standardized timing protocols to ensure comparable developmental progression across experiments.

4. Media Composition Effects:

  • Document complete media composition, as nutrient availability can affect pH sensing and response mechanisms.

  • Consider interactions between pH and other environmental variables (temperature, carbon source, nitrogen availability) .

  • Test defined minimal media versus complex media to identify potential cofactors influencing RIM9 function.

5. Methodological Resolution Framework:

  • Create a decision tree for systematically testing hypotheses that might explain contradictory results.

  • Design controlled experiments that isolate specific variables one at a time.

  • Implement matrix experimental designs that simultaneously test multiple parameters and identify interaction effects.

6. Statistical Approaches:

  • Apply appropriate statistical methods that account for biological variability in filamentous fungi.

  • Consider multivariate analysis when multiple parameters (growth rate, sporulation efficiency, pH modulation) are measured concurrently .

  • Determine statistical power necessary to detect biologically meaningful differences.

7. Comparative Analysis:

  • Reference findings from related fungi (particularly S. cerevisiae) to provide context for contradictory observations .

  • Consider evolutionary divergence in RIM9/RIM101 pathway functions when interpreting inter-species comparisons.

By implementing this structured analytical approach, researchers can systematically resolve contradictory findings and develop a more comprehensive understanding of RIM9 function across various experimental conditions.

What are the recommended protocols for assessing the purity and activity of recombinant RIM9 protein?

Evaluating the purity and activity of recombinant RIM9 protein requires multiple complementary techniques. The following comprehensive protocol is recommended for researchers working with this protein:

Purity Assessment:

  • SDS-PAGE Analysis:

    • Run the recombinant protein on a 10-12% polyacrylamide gel

    • Compare against molecular weight standards (RIM9 is 266 amino acids)

    • Confirm >90% purity as indicated by manufacturer specifications

    • Perform densitometric analysis of stained gels to quantify purity percentage

  • Western Blot Verification:

    • Use anti-His antibodies to detect the His-tagged RIM9 protein

    • Confirm protein integrity by checking for absence of degradation products

    • Consider using A. gossypii-specific antibodies if available to verify native conformation

Functional Activity Assessment:

  • pH-Dependent Binding Assays:

    • Evaluate protein interactions with known partners across pH gradient (pH 6.5-8.5)

    • Monitor binding kinetics using surface plasmon resonance or similar techniques

    • Compare binding profiles between recombinant RIM9 and native protein extracts

  • Membrane Association Analysis:

    • Assess membrane integration using liposome reconstitution assays

    • Confirm proper folding through circular dichroism spectroscopy

    • Evaluate pH-dependent conformational changes that might indicate sensing functionality

  • Signaling Pathway Reconstitution:

    • Test ability to complement rim9 mutant phenotypes in cellular assays

    • Assess interaction with downstream RIM101 pathway components

    • Measure signal transduction efficiency across varying pH conditions

Quality Control Parameters:

  • Protein concentration should be accurately determined using BCA or Bradford assays

  • Endotoxin levels should be monitored, especially for experiments involving cellular systems

  • Batch-to-batch variation should be assessed and documented

Implementing this multi-faceted approach ensures that researchers can confidently assess both the structural integrity and functional capacity of recombinant RIM9 protein preparations.

What are effective strategies for optimizing transformation efficiency in Ashbya gossypii?

Optimizing transformation efficiency in A. gossypii requires careful consideration of several parameters due to its filamentous growth and unique genetic characteristics. The following strategies have proven effective in enhancing transformation outcomes:

Pre-transformation Culture Optimization:

  • Use young, actively growing mycelia harvested during early logarithmic phase .

  • Cultivate A. gossypii in full medium (AFM: 1% yeast extract, 1% peptone, 2% dextrose) for optimal pre-transformation viability .

  • Maintain consistent culture conditions (temperature, aeration) to ensure reproducibility across experiments.

Electroporation Parameter Optimization:

  • Fine-tune electroporation voltage, capacitance, and resistance settings through systematic testing.

  • Determine optimal DNA concentration for transformation (typically 1-5 μg of purified targeting cassette).

  • Use fresh electroporation cuvettes with 2 mm gap distance for consistent electrical field distribution .

Targeting Cassette Design Considerations:

  • Include extended homology regions (45+ bp) flanking the target gene to enhance homologous recombination efficiency .

  • Use established plasmid templates like pFA-GEN3 for generating deletion cassettes .

  • Ensure high purity of PCR products through gel extraction or specialized purification methods.

Post-transformation Selection Strategies:

  • Implement optimal G418/geneticin concentration (200 μg/mL) for effective selection of transformants .

  • Allow for sufficient expression time (4-6 hours) before applying selective pressure.

  • Utilize regeneration media with osmotic stabilizers prior to selection to enhance recovery.

Heterokaryotic to Homokaryotic Conversion:

  • Recognize that initial transformants are typically heterokaryotic (containing both wild-type and transformed nuclei) .

  • Implement systematic spore isolation from heterokaryotic mycelia to obtain homokaryotic transformants .

  • Confirm homokaryotic status through diagnostic PCR and phenotypic analysis .

Verification and Troubleshooting Framework:

  • Use multiplex PCR strategies to verify both gene deletion and correct integration of targeting cassettes .

  • Implement control transformations to establish baseline efficiency for each experimental series.

  • Maintain detailed records of transformation parameters to identify optimal conditions for specific genetic modifications.

By implementing these optimized strategies, researchers can significantly enhance transformation efficiency in A. gossypii, facilitating more effective genetic manipulation for studying RIM9 and related gene functions.

How does the function of RIM9/RIM101 in Ashbya gossypii compare to its orthologues in pathogenic fungi?

The RIM9/RIM101 system in A. gossypii shares significant functional similarities with orthologous systems in pathogenic fungi, while also displaying distinct species-specific adaptations. This comparative analysis provides valuable insights for researchers studying pH-responsive pathways across fungal species:

Conserved Functions Across Fungal Species:

  • In both A. gossypii and pathogenic fungi like Candida albicans, the RIM101 pathway mediates responses to environmental pH changes .

  • The core signaling mechanism involving proteolytic activation of the RIM101/PacC transcription factor appears conserved across diverse fungal lineages .

  • The pathway generally promotes adaptation to alkaline environments in both saprophytic and pathogenic species .

Pathogenicity-Specific Adaptations:

  • In pathogenic fungi such as Candida albicans, the RIM101 pathway has been specifically linked to virulence, with pH sensing being critical for host invasion and persistence .

  • Many pathogenic species utilize the RIM101 pathway to regulate morphological transitions (yeast-to-hyphal switching) that are directly associated with pathogenicity .

  • PacC orthologs play essential roles in pulmonary pathogenesis in Aspergillus species, whereas in A. gossypii, the pathway primarily regulates growth and sporulation .

Developmental Regulation Differences:

  • In A. gossypii, RIM101 is specifically required for sporulation at alkaline pH but dispensable for sporulation under acidic conditions .

  • This contrasts with S. cerevisiae, where RIM101 is universally required for sporulation regardless of pH conditions through regulation of IME1 .

  • Pathogenic fungi often show integration between pH sensing and host-specific signals that is absent in non-pathogenic species like A. gossypii.

Environmental Adaptation Strategies:

  • A. gossypii actively modifies environmental pH during growth and development, alkalinizing acidic media and acidifying alkaline media .

  • This pH modulation capability appears linked to developmental processes and differs from the strategies employed by some pathogenic fungi that must adapt to relatively fixed host pH environments.

This comparative perspective provides a valuable framework for researchers to understand the evolutionary conservation and divergence of pH-responsive pathways across fungal lineages, potentially informing antifungal development strategies targeting conserved pathway components.

How can research on A. gossypii RIM9/RIM101 contribute to understanding fungal pathogenesis?

Research on the A. gossypii RIM9/RIM101 system offers significant translational value for understanding fungal pathogenesis through several key mechanisms:

Model System Advantages:

  • A. gossypii provides a genetically tractable, non-pathogenic model for studying conserved pH response pathways that are critical virulence determinants in pathogenic fungi .

  • The close evolutionary relationship between A. gossypii and pathogenic yeasts (sharing 95% gene homology with S. cerevisiae) facilitates direct comparisons and functional predictions .

  • The completed A. gossypii genome sequence and established genetic manipulation techniques enable comprehensive functional studies that may be more challenging in pathogenic species .

Morphological Transition Insights:

  • Understanding how the RIM101 pathway regulates the transition between filamentous and yeast-like growth in A. gossypii provides valuable insights into similar morphological switches that are virulence determinants in dimorphic pathogens like Candida albicans .

  • Research has demonstrated that in both A. gossypii and pathogenic fungi, pH-responsive pathways integrate environmental signals with developmental programs .

Conserved Signaling Mechanisms:

  • The core components of the RIM9/RIM101 pathway, including RIM13/ADR274C and RIM20/AER342C, are highly conserved between A. gossypii and pathogenic fungi .

  • Detailed characterization of signal transduction in A. gossypii can elucidate conserved mechanisms that might represent targets for broad-spectrum antifungal development.

Stress Response Correlations:

  • The pH response in A. gossypii correlates with other stress adaptation mechanisms that are similarly important for pathogen survival in host environments .

  • Understanding how RIM9/RIM101 interacts with other signaling pathways may reveal vulnerabilities in pathogen adaptation strategies.

Translational Research Applications:

  • Identified RIM9/RIM101 pathway components in A. gossypii can be validated as potential drug targets through comparative studies in pathogenic fungi.

  • A. gossypii can serve as a safe surrogate for initial high-throughput screening of compounds targeting conserved pH-response pathway components.

  • Genetic modifications that disrupt pH sensing in A. gossypii can be translated to pathogenic species to evaluate impacts on virulence in appropriate model systems.

This translational approach leverages the experimental advantages of A. gossypii to accelerate understanding of fundamental pH-sensing mechanisms that contribute to fungal pathogenesis, potentially informing novel therapeutic strategies.

What emerging technologies could enhance the study of RIM9 protein dynamics in Ashbya gossypii?

Several cutting-edge technologies offer promising approaches for investigating RIM9 protein dynamics in A. gossypii with unprecedented resolution and detail:

Advanced Imaging Technologies:

  • Super-Resolution Microscopy:

    • Techniques such as PALM, STORM, or STED microscopy could resolve RIM9 localization with nanometer precision

    • Multi-color super-resolution imaging could simultaneously track RIM9 interactions with other pathway components

    • Time-resolved super-resolution approaches could capture dynamic changes in response to pH shifts

  • Live-Cell Voltage/pH Sensing:

    • Genetically encoded pH sensors fused to RIM9 could provide real-time visualization of local pH environments

    • Correlative voltage and pH imaging could link membrane potential changes with RIM9 activity

    • Light-sheet microscopy could enable long-term imaging of RIM9 dynamics with minimal phototoxicity

Gene Editing and Functional Genomics:

  • CRISPR-Cas9 Applications:

    • Base editing technology could introduce precise mutations to study structure-function relationships

    • CRISPRi/CRISPRa systems could enable temporal control of RIM9 expression

    • Prime editing could facilitate introducing sophisticated modifications to study RIM9 domains

  • Synthetic Biology Approaches:

    • Optogenetic control of RIM9 activity could allow precise temporal manipulation of pathway activation

    • Engineered protein scaffolds could artificially organize RIM9 with pathway components to study interaction dynamics

    • Synthetic pH-responsive circuits could be designed to probe RIM9 function in controlled cellular contexts

Structural and Interaction Proteomics:

  • Cryo-EM Analysis:

    • High-resolution structural determination of RIM9 and associated complexes

    • Visualization of conformational changes in response to pH shifts

    • Structure-guided design of specific inhibitors or activators

  • Proximity Labeling Technologies:

    • BioID or APEX2 fusions with RIM9 could identify transient interaction partners

    • Spatially resolved proteomics could map RIM9 interaction networks in specific cellular compartments

    • Quantitative interaction proteomics across pH gradients could reveal condition-specific interactions

Systems Biology Integration:

  • Multi-omics Approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data to construct comprehensive models of RIM9 function

    • Network analysis to position RIM9 within broader cellular signaling architectures

    • Machine learning algorithms to predict RIM9 activities based on multiple cellular parameters

These emerging technologies, individually or in combination, offer transformative potential for understanding RIM9 dynamics and function in A. gossypii, potentially revealing novel insights into fungal pH sensing and response mechanisms.

What are the key unresolved questions regarding RIM9 function that warrant further investigation?

Despite significant advances in understanding the RIM101 pathway in fungi, several critical questions regarding RIM9 function in A. gossypii remain unresolved and represent important areas for future research:

Structural and Mechanistic Questions:

  • What is the precise three-dimensional structure of RIM9, and how does this structure change in response to different pH environments?

  • Does RIM9 function as a direct pH sensor, or does it primarily transduce signals from other pH-sensing components?

  • What are the specific protein-protein interaction domains within the 266-amino acid sequence of RIM9 that facilitate signal transduction ?

Pathway Integration Questions:

  • How does the RIM9/RIM101 pathway interact with other signaling networks in A. gossypii, particularly those involved in sporulation and stress response?

  • What is the exact position of RIM9 within the signaling cascade, and which proteins act as direct upstream activators and downstream effectors?

  • How is RIM9 activity regulated post-translationally (phosphorylation, ubiquitination, etc.) in response to changing environmental conditions?

Developmental Biology Questions:

  • How does RIM9 contribute to the pH-dependent sporulation observed in A. gossypii, and what specific developmental genes are regulated through this pathway ?

  • Does RIM9 play different roles during distinct developmental stages of A. gossypii's life cycle?

  • How does RIM9 contribute to the active pH modulation observed in A. gossypii cultures during growth and sporulation ?

Evolutionary Biology Questions:

  • How has RIM9 function diverged between A. gossypii and related fungi, particularly in relation to sporulation regulation at different pH levels ?

  • What selective pressures have shaped the specific adaptations in the A. gossypii RIM9/RIM101 pathway compared to pathogenic fungi?

  • Can evolutionary analysis of RIM9 across fungal lineages reveal functional domains under strong selection versus those that show greater plasticity?

Applied Research Questions:

  • Can manipulation of the RIM9/RIM101 pathway be leveraged to enhance desirable traits in A. gossypii, such as riboflavin production?

  • Could insights from A. gossypii RIM9 function inform development of novel antifungal strategies targeting conserved pH-sensing mechanisms in pathogenic fungi?

  • How might environmental pH manipulation be utilized to control fungal development through RIM9/RIM101 pathway modulation?

Addressing these unresolved questions will significantly advance our understanding of pH sensing in fungi and potentially reveal novel applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.