Recombinant Ashbya gossypii Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ashbya gossypii PAM17

Recombinant Ashbya gossypii Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17), is a component of the presequence translocase-associated motor (PAM) complex found in the inner mitochondrial membrane . The PAM complex is essential for importing proteins containing transit peptides into the mitochondrial matrix . PAM17 is a regulatory subunit of the PAM complex that influences the association of Pam18 and Pam16 in the J-complex and is required for efficient protein import .

Role in Mitochondrial Protein Import

PAM17 plays a crucial role in the import of proteins into mitochondria . It is involved in an early stage of protein translocation, facilitating the interaction of Ssc1 (mitochondrial heat shock protein 70) with the incoming polypeptide . Studies using pam17Δ mitochondria (mitochondria lacking Pam17) have shown an import defect with selected matrix-targeted precursors, indicating its importance in posttranslational protein import .

Interaction with the TIM23 Complex

PAM17 interacts with the TIM23 complex, specifically binding to the channel protein Tim23 . This interaction reveals a new binding site between TIM23 and PAM, suggesting that Tim23 functions not only as a protein import channel but also as a binding site for the regulatory subunit Pam17 . The assembly of the mitochondrial protein import motor involves a regulated interplay of several membrane-bound cochaperones, including Pam17 . These cochaperones interact differently with the presequence translocase and possess both stimulatory and inhibitory characteristics .

Functional Cooperation with Tim44

Pam17 and Tim44 cooperate in protein import, with Pam17 involved in an early step and Tim44 assisting in a later step of transport . Inactivation of Tim44 enhances the association of Pam17 with the TIM23 complex . A study using a conditional allele, termed tim44-804, showed that inactivation of Tim44 leads to a reorganization within the TIM23-PAM machinery, where the J-complex dissociates from the translocase, while Pam17 binding to Tim23 is strongly enhanced .

Genetic and Biochemical Analysis of PAM17

Genetic and biochemical analyses of the PAM17 gene have demonstrated its requirement for efficient posttranslational protein import . The deletion of PAM17 in combination with mutants of essential genes of the import motor, SSC1 and TIM44, led to a synthetic enhancement of the single phenotypic effects . This indicates an overlapping functional cooperation of Pam17 and Tim44 in protein import .

Rsp5 and Pam17 in Preprotein Removal

Rsp5, an E3 ubiquitin ligase, and Pam17 are involved in the removal of non-imported mitochondrial preproteins . Deletion of PAM17 in the rsp5-1 yeast mutant resulted in a synthetic growth defect and accumulation of the Mdj1 precursor, indicating that Rsp5 has a role in the removal of non-imported preproteins .

Available Recombinant Forms

Recombinant Ashbya gossypii PAM17 is available for purchase in various forms, produced in different expression systems :

  • Yeast

  • E. coli

  • E. coli (Avi-tag Biotinylated)

  • Baculovirus

  • Mammalian cell

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAM17; ADR328W; Presequence translocated-associated motor subunit PAM17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-186
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
PAM17
Target Protein Sequence
QAAGSTSGRELSWPDFFALRKTERRINTGSSVLTAFLTANCAWAYISTVQIDVTQMLFGF DPMVVLVGALFASSGLGYLCGPLMGSAFFRVKHRGQLEGYNHKNRVFLEHIKKNRVDASS QSFSNPLPDYYGEKIGSLQEYRQWLRDCQSHRRKAKEFL
Uniprot No.

Target Background

Function

Recombinant Ashbya gossypii Presequence translocated-associated motor subunit PAM17, mitochondrial (PAM17) is a component of the PAM complex. This complex is essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the mitochondrial matrix.

Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of PAM17 in mitochondrial protein import?

PAM17 functions as a regulatory component of the Presequence translocase-Associated Motor (PAM) complex, which is essential for protein import into the mitochondrial matrix. The PAM complex works in conjunction with the TIM23 complex to facilitate the ATP-dependent translocation of preproteins across the inner mitochondrial membrane. PAM17 specifically contributes to the architecture of the import motor and appears to play a role in the association of other components to the TIM23 translocase .

Research indicates that PAM17 is particularly involved in the reorganization of the translocase during the import process. It has been suggested that PAM17 plays a role in the association of the Pam16/Pam18 complex to the translocase after the release of Tim21, which is necessary for the transition from the TIM23SORT to the TIM23MOTOR complex configuration . This reorganization is critical for the efficient import of matrix-targeted proteins.

What are the recommended storage conditions for recombinant PAM17?

For optimal stability and activity maintenance of recombinant PAM17, the following storage conditions are recommended:

  • For short-term storage (up to one week): Store working aliquots at 4°C .

  • For extended storage: Store at -20°C or preferably -80°C .

  • Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for this protein .

It is important to note that repeated freezing and thawing cycles significantly reduce protein stability and activity. Therefore, it is advisable to prepare small working aliquots after initial reconstitution . The shelf life of the liquid form is typically 6 months at -20°C/-80°C, while the lyophilized form maintains stability for approximately 12 months at -20°C/-80°C .

How can researchers effectively reconstitute lyophilized PAM17 for experimental use?

For optimal reconstitution of lyophilized recombinant PAM17, follow this methodological approach:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to bring all contents to the bottom of the tube .

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enhance stability during storage .

  • Gently mix by inversion rather than vortexing to avoid protein denaturation.

  • Aliquot into small volumes for long-term storage at -20°C/-80°C to minimize freeze-thaw cycles .

When preparing working solutions, allow the protein to equilibrate to room temperature before opening the vial to prevent condensation that could introduce water and potentially degradative enzymes into the sample.

What experimental approaches can be used to study PAM17's role in mitochondrial protein import?

Several methodological approaches can be employed to investigate PAM17's function:

  • In vitro protein import assays: Using isolated mitochondria and radiolabeled or fluorescently tagged precursor proteins to assess import efficiency in the presence or absence of functional PAM17 .

  • Co-immunoprecipitation studies: To identify and characterize protein-protein interactions between PAM17 and other components of the import machinery, particularly its associations with the TIM23 complex .

  • Site-directed mutagenesis: Introducing specific mutations in the PAM17 gene to identify functionally important residues and domains, followed by functional complementation studies .

  • Fluorescence microscopy with GFP-tagged constructs: To visualize the subcellular localization of PAM17 and its potential colocalization with other import components .

  • Comparative studies: Analyzing the function of PAM17 across different fungal species such as Ashbya gossypii and Saccharomyces cerevisiae to identify conserved and species-specific aspects of its function .

These approaches, often used in combination, can provide comprehensive insights into the specific roles of PAM17 in the mitochondrial protein import process.

How does PAM17 contribute to the reorganization of the presequence translocase?

PAM17 plays a crucial role in the dynamic reorganization of the TIM23 translocase during protein import. Current research suggests that PAM17 functions in the transition between different functional states of the translocase :

  • The TIM23SORT state: In this configuration, the translocase remains motor-free and promotes inner membrane sorting of proteins with stop-transfer signals. This state is characterized by the presence of Tim21 .

  • The TIM23MOTOR state: This configuration involves the association of the PAM complex with the translocase, which requires the release of Tim21. This state is necessary for the complete translocation of proteins into the mitochondrial matrix .

PAM17 appears to facilitate the association of the Pam16/Pam18 complex to the TIM23 translocase after Tim21 release . This transition is critical for the activation of the import motor and subsequent ATP-dependent translocation.

Research has shown that the interaction between the IMS-domains of Tim21 (Tim21IMS) and Tim50 (Tim50IMS) plays an important role in this process. These domains interact with an affinity approximately 10-fold greater than that of Tim50 to presequences . The presence of a presequence peptide likely induces structural changes in Tim50 that affect its interaction with Tim21, thereby initiating the reorganization of the translocase.

What are the differences between PAM complexes in Ashbya gossypii and other model organisms?

Comparative studies of protein import machinery between A. gossypii and other fungi, particularly Saccharomyces cerevisiae, reveal interesting evolutionary adaptations:

  • Conservation of core components: The basic components of the PAM complex, including PAM17, are conserved between A. gossypii and S. cerevisiae, suggesting fundamental mechanistic similarities in protein import .

  • Phenotypic differences: Previous studies have shown that mutations in syntenic homologs of S. cerevisiae genes often produce more severe phenotypes in A. gossypii. This difference is attributed to the fast and strictly filamentous growth of A. gossypii, which depends on a highly dynamic actin cytoskeleton .

  • Plant homologs: In contrast to fungal systems, plant orthologues show interesting differences. While some PAM complex interacting partners like Tim15 and Mge1 are dual-targeted to both mitochondria and plastids in plants, studies in Arabidopsis show that Pam16 is exclusively targeted to mitochondria, whereas Pam18 orthologues can be dual-targeted to both organelles .

This table summarizes the localization patterns of plant PAM complex proteins:

ProteinMitochondrial LocalizationPlastid LocalizationNotes
Pam16-1YesNoExclusive mitochondrial targeting in all methods tested
Pam16-2YesNoExclusive mitochondrial targeting in all methods tested
Pam18-1YesYesDual targeting depends on methodology; exclusively plastid-targeted in biolistic transformation
Pam18-2YesYesDual targeting in transient assays; exclusively mitochondrial in stable GFP plants
Pam18-3YesYesDual targeting in most assays; mitochondrial when using native promoter

These comparative analyses provide valuable insights into the evolution and functional specialization of the protein import machinery across different organisms.

What controls should be included when studying PAM17's role in protein import?

When investigating PAM17's function in mitochondrial protein import, the following controls are essential for data interpretation:

  • Positive controls: Include well-characterized matrix-targeted preproteins with known import kinetics, such as the F1β subunit of ATP synthase or mitochondrial malate dehydrogenase.

  • Negative controls: Use proteins that don't contain mitochondrial targeting sequences or mutated preproteins that are import-incompetent.

  • Temperature controls: Perform parallel import reactions at 4°C to distinguish between binding and complete translocation, as low temperature inhibits the translocation step but not initial binding.

  • Energy controls: Include samples with and without ATP/NADH to verify the energy dependence of PAM complex-mediated import.

  • Membrane potential controls: Use ionophores like CCCP to dissipate the membrane potential and confirm its requirement for presequence-mediated import.

When analyzing protein-protein interactions involving PAM17:

  • Use antibodies against other PAM complex components to verify specific interactions versus non-specific binding.

  • Include competition assays with recombinant proteins or synthetic peptides to validate the specificity of observed interactions.

  • Perform reciprocal immunoprecipitations to confirm interaction results.

How can researchers validate the functionality of recombinant PAM17?

To confirm that recombinant PAM17 maintains its native functional properties:

  • Structural integrity assessment: Use circular dichroism spectroscopy to verify proper protein folding and secondary structure elements.

  • Interaction studies: Perform binding assays with known interaction partners such as components of the TIM23 complex to confirm that the recombinant protein retains its ability to form appropriate protein-protein interactions.

  • Functional complementation: Test whether the recombinant protein can rescue phenotypic defects in PAM17-depleted or mutant mitochondria in in vitro import assays.

  • Activity assays: Although PAM17 does not possess enzymatic activity itself, researchers can assess its ability to facilitate the reorganization of the translocase by monitoring the association of Pam16/Pam18 to the TIM23 complex in reconstitution experiments.

  • Thermal stability assays: Use differential scanning fluorimetry to assess protein stability and compare it with expected values for properly folded protein.

Protein purity should be ≥85% as verified by SDS-PAGE , and batch-to-batch consistency should be monitored using standardized quality control metrics to ensure reproducible experimental results.

What are emerging research areas involving PAM17 that deserve further investigation?

Several promising research directions could advance our understanding of PAM17:

  • Structural studies: Determining the high-resolution structure of PAM17 and its complexes with other import components would provide valuable insights into its molecular mechanism of action.

  • Regulatory mechanisms: Investigating potential post-translational modifications of PAM17 and how they might regulate its function in response to cellular conditions.

  • Systems biology approaches: Integrating proteomic, transcriptomic, and metabolomic data to understand how PAM17 functions within the broader context of mitochondrial biogenesis and cellular metabolism.

  • Evolutionary analysis: Comparative studies of PAM17 across diverse fungal species could reveal evolutionary adaptations in protein import machinery that correlate with different cellular morphologies and lifestyles, particularly given the observed phenotypic differences between S. cerevisiae and the filamentous A. gossypii .

  • Interaction with stress response: Investigating whether PAM17 plays a role in adapting mitochondrial protein import to various cellular stresses, similar to what has been observed for other components of the import machinery.

These research directions could significantly advance our understanding of mitochondrial protein import and potentially reveal new therapeutic targets for diseases associated with mitochondrial dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.