Recombinant Ashbya gossypii Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
LCL3; AFL066C; AGOS_AFL066C; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
LCL3
Target Protein Sequence
MSDNSVATPAHLLQAKVIFLSFLLTGGFVATYSAFNRHLRQITSVHDIPTNVFRRKYLYG KVTSVGDGDNFLFFHTPGGVLGGWHWLRKVPTLQRKGILPRRAQKATGNALSTLSPLNLF RGLVGLRSEGGGRDQFALYRGRRKLPTLSIRLCGVDAPERAHFGNSSQPLSEEAYKWLNK TLLGRFVWVKPLSTDQYGRCVAKVEYWSWFRWKNVSIELLKQGLGVVYESKSGAEFDGQD TLYRYHESKAKKSKRGVWGLRHFETPGAYKKRINKQ
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Ashbya gossypii and why is it significant for biotechnology research?

    Ashbya gossypii (synonym: Eremothecium gossypii) is a filamentous fungus belonging to the Saccharomycetaceae family that has long been considered a paradigm of White Biotechnology. It gained industrial significance primarily for its naturally high production of riboflavin (vitamin B2). Its industrial relevance has led to the development of significant molecular and in silico modeling tools for its manipulation . The fungus has been used by BASF since 1990 for industrial riboflavin production, and has since become a model organism for additional biotechnological applications including recombinant protein production, single cell oils (SCOs), and flavor compounds .

  • What is the LCL3 protein and what is its predicted function?

    LCL3 (gene name: AFL066C, AGOS_AFL066C) is classified as a probable endonuclease (EC 3.1.-.-) in Ashbya gossypii . Endonucleases are enzymes that cleave phosphodiester bonds within polynucleotide chains. While the precise biological function of LCL3 has not been extensively characterized in the provided literature, its classification suggests it plays a role in nucleic acid metabolism, potentially involved in DNA repair, recombination, or RNA processing mechanisms .

  • What expression systems are available for producing recombinant Ashbya gossypii LCL3?

    Recombinant Ashbya gossypii LCL3 can be produced using multiple expression systems, each offering different advantages for research applications:

    Expression SystemCharacteristicsApplications
    E. coliHigh yield, simple cultivation, cost-effectiveBasic structural studies, antibody production
    YeastPost-translational modifications, protein foldingFunctional studies requiring eukaryotic processing
    BaculovirusComplex eukaryotic modifications, high expressionStructural biology, functional assays
    Mammalian cellsMost authentic post-translational modificationsStudies requiring mammalian-like glycosylation

    The choice depends on research requirements regarding protein folding, post-translational modifications, and downstream applications .

Advanced Research Questions

  • How can Ashbya gossypii be genetically modified for enhanced expression of recombinant proteins like LCL3?

    Genetic modification of Ashbya gossypii for enhanced recombinant protein expression involves multiple strategies:

    1. Promoter optimization: Substituting the commonly used Saccharomyces cerevisiae PGK1 promoter with native A. gossypii promoters such as AgTEF and AgGPD has shown 8-fold improvement in heterologous protein expression .

    2. Vector optimization: Removal of terminator sequences with autonomous replicating activity in A. gossypii (like the ScADH1 terminator) has demonstrated 2-fold improvements in recombinant protein production .

    3. Signal sequence engineering: A. gossypii can recognize signal peptides from other organisms as secretion signals, allowing optimization of protein secretion through signal peptide selection .

    4. Culture medium optimization: Using glycerol instead of glucose as carbon source has shown 1.5-fold higher recombinant protein production, suggesting carbon source optimization is a critical factor .

    5. Integration of stable expression cassettes: For long-term production, stable integration into the genome is preferable to episomal expression .

  • What methodological approaches can be used to characterize the enzymatic activity of recombinant LCL3?

    Characterizing enzymatic activity of recombinant LCL3 as a probable endonuclease would typically involve:

    1. Substrate specificity assays: Using different DNA/RNA substrates (circular/linear, single/double-stranded) incubated with purified recombinant LCL3 and analyzing cleavage patterns by gel electrophoresis.

    2. Kinetic analysis: Determining enzyme parameters (Km, Vmax, kcat) through time-course experiments with varying substrate concentrations.

    3. Cofactor requirements: Testing activity in presence/absence of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺) which typically influence endonuclease function.

    4. pH and temperature optima: Determining optimal reaction conditions by measuring activity across pH range (5-9) and temperatures (25-65°C).

    5. Inhibitor studies: Using known endonuclease inhibitors to characterize the active site properties.

    6. Structural analysis: Combining with crystallography or cryo-EM studies to correlate structure with function.

  • How does the biotechnological potential of Ashbya gossypii compare with other microbial expression systems for recombinant protein production?

    Ashbya gossypii offers several advantages compared to conventional expression systems:

    FeatureA. gossypiiS. cerevisiaeP. pastorisE. coliAdvantage
    Secretion capacityHighModerateHighLowEasier downstream processing
    Extracellular protease activityNegligibleLowModerateHighReduced protein degradation
    GlycosylationN-glycans similar to non-conventional yeastHyperglycosylationLess extensive than S. cerevisiaeNoneBetter bioactivity for certain proteins
    Growth substratesCan use waste-derived substratesRequires defined mediaMethanol/glycerolDefined mediaCost-effective production
    Scale-up potentialDemonstrated industrial scaleIndustrial scaleIndustrial scaleIndustrial scaleProven large-scale capability
    Native secreted proteinsLow varietyModerateLowHighLess contamination

    A. gossypii can secrete native and heterologous enzymes to the extracellular medium and recognize signal peptides from other organisms. It has negligible extracellular protease activity, which facilitates downstream processing. For β-galactosidase production, A. gossypii achieved up to 1127 U/mL, compared to up to 3000 U/mL in A. niger .

  • What metabolic engineering strategies can be used to optimize Ashbya gossypii as a host for recombinant protein production?

    Advanced metabolic engineering strategies for optimizing A. gossypii as a recombinant protein host include:

    1. Carbon flux redirection: Engineering the central carbon metabolism to divert carbon toward amino acid biosynthesis and energy production pathways essential for protein synthesis.

    2. Cofactor balancing: Optimizing NADPH/NADH ratios which are critical for protein folding and disulfide bond formation in secreted proteins.

    3. Secretion pathway engineering: Overexpression of chaperones (BiP, PDI) and components of the secretory pathway to alleviate bottlenecks in protein folding and export.

    4. Stress response modification: Engineering the unfolded protein response (UPR) to better handle high recombinant protein loads.

    5. Integration with systems biology: Utilizing the genome-scale metabolic model of A. gossypii to predict optimal genetic modifications for enhanced protein production .

    6. Medium composition optimization: Fine-tuning medium components based on specific amino acid requirements of the target protein.

  • How can the functional role of LCL3 in Ashbya gossypii biology be investigated?

    Investigating the functional role of LCL3 in A. gossypii would require:

    1. Gene knockout studies: Creating LCL3 deletion mutants to observe phenotypic effects on growth, morphology, and stress responses.

    2. Localization studies: Tagging LCL3 with fluorescent markers to determine subcellular localization.

    3. Protein interaction studies: Using pull-down assays, yeast two-hybrid, or co-immunoprecipitation to identify protein partners.

    4. Transcriptome analysis: Comparing gene expression patterns between wild-type and LCL3 knockout strains to identify pathways affected.

    5. Substrate identification: Using techniques like CLIP-seq to identify nucleic acid binding sites in vivo.

    6. Complementation studies: Expressing LCL3 in knockout strains to verify phenotype rescue.

    7. Comparative genomics: Examining conservation and evolution of LCL3 across related fungal species.

  • What are the challenges of expressing eukaryotic endonucleases like LCL3 in prokaryotic expression systems?

    Expressing eukaryotic endonucleases in prokaryotic systems presents several challenges:

    1. Protein toxicity: Endonucleases may cleave host DNA, leading to toxicity that prevents high-level expression.

    2. Codon bias: Differences in codon usage between fungi and bacteria may limit translation efficiency.

    3. Lack of post-translational modifications: Prokaryotes cannot perform certain modifications that may be required for activity.

    4. Protein folding: The bacterial cytoplasm lacks appropriate chaperones for eukaryotic protein folding.

    5. Disulfide bond formation: Limited capacity for disulfide bond formation in bacterial cytoplasm.

    Methodological solutions include:

    • Using tightly controlled inducible promoters

    • Co-expression with specific chaperones

    • Expression as fusion proteins with solubility-enhancing partners

    • Direction to periplasmic space for disulfide bond formation

    • Codon optimization of the synthetic gene

  • How can recombinant LCL3 be integrated into studies of Ashbya gossypii's biotechnological applications?

    Recombinant LCL3 could be integrated into broader A. gossypii biotechnology in several ways:

    1. Metabolic engineering tool: If LCL3 has roles in DNA recombination, it could potentially be used to enhance homologous recombination efficiency for strain engineering.

    2. Bioprocess improvement: Understanding LCL3's role in A. gossypii metabolism might reveal new targets for improving production strains for riboflavin, lactones, or nucleosides.

    3. Stress response research: As nucleases often play roles in stress responses, LCL3 characterization could improve strain robustness in industrial conditions.

    4. Nucleic acid processing: If LCL3 has specific nuclease activity, it could be developed as a biotechnological tool for DNA/RNA manipulation.

    5. Metabolite production: A. gossypii has been engineered for inosine production (up to 2.2 g/L) , and understanding nucleic acid metabolism enzymes like LCL3 might further optimize nucleoside production pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.