Recombinant Ashbya gossypii Protein ROT1 (ROT1)

Shipped with Ice Packs
In Stock

Description

Introduction

ROT1 is an essential protein identified in Saccharomyces cerevisiae (S. cerevisiae) and other yeast species . ROT1 was initially discovered through a search for suppressor mutations that could counteract the lethal effects of a tor2 ts mutant strain, which is deficient in actin cytoskeleton function . ROT1 is also required for maintaining normal levels and structure of cell wall components . It is involved in a morphogenetic process affecting cell wall biosynthesis and may function with Kar2 in protein folding within the endoplasmic reticulum .

Basic Information

ROT1 is predicted to contain 256 amino acids and has a molecular mass of approximately 29 kDa . Sequence analysis reveals a transmembrane domain at its C-terminus, indicating that Rot1 is an integral membrane protein primarily located within the nuclear envelope and ER system . Homologues of Rot1p with high identity and predicted transmembrane domains are found in Candida albicans and Schizosaccharomyces pombe .

Function

ROT1 is an essential gene, and its inactivation leads to defects in cell cycle progression and morphogenesis in budding yeast . Deletion of ROT1 causes cell aggregation and abnormal cell morphology .

  • Cell Cycle Progression: Studies have shown that cells lacking functional Rot1 exhibit an increased percentage of budded cells and cells with segregated nuclei, indicating a defect in cell cycle progression and a partial arrest at the later stages due to defective cytokinesis .

  • Cell Wall Integrity: rot1Δ cells exhibit resistance to K1 killer toxin and hypersensitivity to SDS and hygromycin B, suggesting cell wall defects . These cells show reduced levels of alkali-soluble and -insoluble 1,6-β-glucan and increased levels of chitin and 1,3-β-glucan .

  • Actin Cytoskeleton Control: Rot1 plays an antagonistic role to Clb2 in actin cytoskeleton functions . It is required for apical growth maintenance and polarized growth at the neck . Rot1 is involved in Clb2 degradation, suggesting that it may control the actin cytoskeleton, at least partially, through regulation of Clb2 protein levels .

Genetic Interactions

  • TOR2: ROT1 genetically interacts with TOR2, which is involved in the regulation of the cell integrity pathway .

  • Cell Integrity Pathway: Partial inactivation of ROT1 causes lethality in cells compromised in Pkc1, the MAPK Slt2, or the GTPase Rho1 . Inactivation of ROT1 also leads to the activation of the MAPK Slt2, suggesting a functional connection between the cell integrity pathway and the function of Rot1 .

  • CLB2: ROT1 and CLB2 genes function antagonistically in the regulation of actin cytoskeleton . ROT1 inactivation suppresses the hyperpolarization defect in clb2 cells .

Role in Riboflavin Production in Ashbya gossypii

Ashbya gossypii naturally overproduces riboflavin and has been utilized for industrial riboflavin production .

  • Disparity Mutagenesis: Genomic analysis of a riboflavin-overproducing mutant of A. gossypii (W122032 strain) isolated by disparity mutagenesis revealed heterozygous mutations in genes involved in the oxidation-reduction process .

  • AgOAF1 Gene: Homozygous mutations in the AgOAF1 gene (AGOS_ADR404C), encoding a subunit of an oleate-activated transcription factor, were found in the genome of a riboflavin-overproducing mutant .

Functional Analysis via Mutagenesis

Growth of a rot1Δ haploid can be partially restored by adding 0.6 M sorbitol to the growth medium . Analysis of the cell cycle showed that rot1Δ cells are delayed at the G2/M phase .

Subcellular Localization

Rot1 is an integral membrane protein mainly located within the nuclear envelope and ER system . Two regions, amino acids 26-60 and 200-228, are involved in the post-translational translocation of Rot1 across the membrane .

Tables

FeatureDescription
Gene NameROT1
Protein NameRot1p
OrganismSaccharomyces cerevisiae
Length256 amino acids
Molecular Weight~29 kDa
LocalizationNuclear envelope and ER system
FunctionCell cycle progression, cell wall integrity, actin cytoskeleton control
Genetic InteractionsTOR2, Cell Integrity Pathway, CLB2
Phenotype of DisruptionCell aggregation, abnormal morphology, cell cycle delay at G2/M phase, cell wall defects, resistance to K1 killer toxin, hypersensitivity to SDS and hygromycin B

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ROT1; AFL175C; Protein ROT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-253
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
ROT1
Target Protein Sequence
QSAKDLYGTWSAKSNQVFTGPGFYNPADELLIEPSLPGISYSFTEDGFFEMATYRVSGNP RNLACPSAVMTFQHGKYEILANGTLILRPFEVDGRQLVSEPCVDKGVSTYLRYSQVETFQ RFAVELDEYQGKHALHLFQFDGSPVQPLYLAYRPPLMLPTITLNPTDHAGATATAGPGHR KRSLGELVRAGLQDKHKTTAVRNPSLFNAAFYWWCSAGVIAAGTVLFFMV
Uniprot No.

Target Background

Function
Essential for maintaining normal levels of cell wall 1,6-beta-glucan. ROT1 participates in protein folding as a chaperone, influencing various physiological processes including cell wall synthesis and autophagic body lysis.
Database Links
Protein Families
ROT1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure and cellular localization of Ashbya gossypii ROT1?

ROT1 in Ashbya gossypii is a small integral membrane protein similar to its homolog in Saccharomyces cerevisiae . This essential protein is embedded in the membrane and plays critical roles in cell wall organization. Based on comparative analysis with S. cerevisiae, AgROT1 likely contains transmembrane domains that anchor it to the endoplasmic reticulum membrane. For structural studies, researchers typically employ techniques including:

  • Membrane protein isolation using detergent-based extraction

  • Structural prediction using bioinformatics tools comparing against S. cerevisiae homologs

  • Epitope tagging followed by immunofluorescence microscopy to confirm localization

When investigating the structure-function relationship, it's critical to consider the membrane topology and protein-protein interaction domains.

How does ROT1 function differ between Ashbya gossypii and Saccharomyces cerevisiae?

While both A. gossypii and S. cerevisiae ROT1 proteins function in cell wall organization, their specific roles likely differ due to the distinct morphology and growth patterns of these fungi. A. gossypii exhibits multinucleated hyphae, whereas S. cerevisiae grows as a unicellular yeast .

Key functional differences include:

  • In A. gossypii, ROT1 likely contributes to the development and maintenance of hyphal structures, potentially influencing the filamentous growth pattern

  • The protein may have adapted to support the multinucleated state of A. gossypii

  • Regulatory networks involving ROT1 might be modified to accommodate the distinct growth phases of A. gossypii, including its trophic and productive phases

For comparative studies, researchers should employ genetic complementation experiments using ROT1 from both organisms to determine functional conservation or divergence.

What phenotypes are associated with ROT1 disruption in Ashbya gossypii?

Based on studies in related fungi, ROT1 null mutants in A. gossypii likely exhibit severe growth defects that can be partially rescued by osmotic stabilization. The following phenotypes are typically observed:

  • Growth arrest or significant retardation due to compromised cell wall integrity

  • Osmotic remediability, where adding 0.6 M sorbitol to the growth medium enables limited growth of mutant cells

  • Potential alterations in hyphal morphology and development

  • Possible impacts on riboflavin production pathways, given the interconnectedness of cellular processes in A. gossypii

Phenotypic characterization should include microscopic analysis of cell wall organization, stress tolerance assays, and assessment of growth rates under various conditions.

What are the optimal conditions for recombinant expression of Ashbya gossypii ROT1?

Expressing recombinant AgROT1 presents challenges due to its membrane protein nature. The following methodology has proven effective:

Expression System Selection:

Host SystemAdvantagesLimitationsRecommended Use
E. coliRapid growth, high yieldImproper folding of eukaryotic membrane proteinsExpression of soluble domains only
Pichia pastorisProper protein folding, post-translational modificationsSlower growth than E. coliFull-length protein expression
S. cerevisiaeNative-like environmentLower yieldsFunctional studies, especially with rot1 mutant complementation

Optimization Protocol:

  • Clone the AgROT1 gene into a vector with an inducible promoter and affinity tag

  • Transform into the selected expression system

  • Test expression using small-scale cultures with varying induction parameters

  • For membrane protein isolation, use mild detergents (e.g., DDM, CHAPS) for solubilization

  • Verify protein integrity by Western blotting before scaling up

For functional studies, expression in a rot1-deficient S. cerevisiae strain can determine whether AgROT1 complements the yeast ortholog's function.

How can CRISPR-Cas9 genome editing be applied to study ROT1 function in Ashbya gossypii?

CRISPR-Cas9 provides a precise tool for manipulating the ROT1 gene in A. gossypii. Implementation requires special considerations due to the multinucleated nature of this organism:

CRISPR-Cas9 Editing Protocol for AgROT1:

  • Design multiple guide RNAs targeting conserved regions of the ROT1 gene

  • Create a repair template containing desired mutations or tags flanked by homology arms (>500 bp recommended)

  • Introduce CRISPR components using transformation methods optimized for A. gossypii

  • Select transformants using appropriate markers, considering the multinucleated state requires extended selection

  • Verify editing by sequencing and confirm homogeneity across nuclei through single spore isolation

  • Conduct phenotypic characterization under various conditions, including osmotic stress tests

For conditional studies, consider creating an auxin-inducible degron system to achieve rapid protein depletion, which is particularly valuable for essential genes like ROT1.

What techniques are most effective for studying ROT1 protein-protein interactions in Ashbya gossypii?

Understanding ROT1's protein interaction network is crucial for elucidating its functions. Several complementary approaches provide robust results:

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Fuse ROT1 to a biotin ligase

    • Express the fusion protein in A. gossypii

    • Identify biotinylated proteins through streptavidin pulldown and mass spectrometry

    • This approach is particularly valuable for membrane proteins like ROT1

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Extract proteins under native conditions with appropriate detergents

    • Perform immunoprecipitation with antibodies against tagged ROT1

    • Identify interacting partners by mass spectrometry

  • Split-reporter systems:

    • Divide a reporter protein (e.g., split-GFP or split-luciferase) between ROT1 and candidate interactors

    • Assess interaction through reconstitution of reporter activity

    • This allows for in vivo validation of specific interactions

When interpreting results, consider that membrane proteins often form complexes dependent on the lipid environment, and verify key interactions using multiple approaches.

How can conditional expression systems be optimized for studying essential genes like ROT1 in Ashbya gossypii?

Since ROT1 is an essential gene in related fungi, conditional expression systems are crucial for functional studies:

Recommended Conditional Systems:

  • Tetracycline-regulated expression:

    • Replace the native ROT1 promoter with a tetracycline-responsive promoter

    • Addition of tetracycline or doxycycline represses gene expression

    • This allows for gradual depletion of the protein, revealing dose-dependent phenotypes

  • Auxin-inducible degron system:

    • Fuse ROT1 with an auxin-inducible degron tag

    • Express the TIR1 F-box protein in the same cells

    • Addition of auxin triggers rapid degradation of the fusion protein

    • This approach allows temporal control of protein depletion

  • Temperature-sensitive allele generation:

    • Create a library of ROT1 mutants and screen for temperature-sensitive phenotypes

    • Characterize identified mutants for specific defects at restrictive temperatures

    • This approach allows for studying specific functional domains

For each system, establish dose-response or time-course experiments to determine optimal conditions for phenotypic analysis while minimizing secondary effects.

What transcriptomic changes occur in response to ROT1 depletion in Ashbya gossypii?

ROT1 depletion likely triggers comprehensive transcriptional responses related to cell wall integrity and stress pathways. A methodological approach for transcriptomic analysis includes:

  • Generate a conditional ROT1 mutant strain using the systems described in 3.1

  • Collect RNA samples at multiple timepoints following ROT1 depletion

  • Perform RNA-seq and compare to wild-type controls

  • Analyze differential gene expression focusing on:

    • Cell wall organization genes

    • Stress response pathways

    • Growth regulation networks

    • Metabolic adaptation, particularly related to riboflavin biosynthesis pathways

Expected transcriptional changes based on fungal cell wall integrity responses include:

  • Upregulation of alternative cell wall synthesis pathways

  • Activation of the protein kinase C (PKC) cell integrity pathway

  • Induction of stress-responsive chaperones

  • Potential cross-talk with metabolic pathways including riboflavin production

How does ROT1 expression change during different growth phases of Ashbya gossypii?

A. gossypii exhibits distinct growth phases, including a trophic phase and a productive phase (associated with riboflavin overproduction) . ROT1 expression likely varies across these phases to support changing cellular needs:

Methodological Approach:

  • Culture A. gossypii under standard conditions

  • Collect samples at defined timepoints corresponding to:

    • Early trophic phase (12-24h)

    • Late trophic phase (24-36h)

    • Transition to productive phase (36-48h)

    • Productive phase (48-72h)

  • Extract RNA and perform RT-qPCR or RNA-seq

  • Normalize ROT1 expression against stable reference genes

Interpreting the results requires consideration of the biological context. For example, if ROT1 expression changes during the transition to the productive phase, this might suggest a role in the metabolic shift toward riboflavin production, potentially linking cell wall organization to metabolic regulation.

How do post-translational modifications affect ROT1 function in Ashbya gossypii?

As an integral membrane protein, ROT1 likely undergoes specific post-translational modifications crucial for its function. Investigating these modifications requires:

  • Identification of modification sites:

    • Express and purify tagged ROT1 protein

    • Perform mass spectrometry analysis targeting:

      • Glycosylation sites (common in secretory pathway proteins)

      • Phosphorylation sites (important for regulation)

      • Ubiquitination sites (relevant for protein turnover)

  • Functional analysis of modifications:

    • Generate site-specific mutants of identified modification sites

    • Assess mutant phenotypes under various conditions

    • Compare protein localization, stability, and interaction partners between wild-type and mutant proteins

  • Dynamic regulation of modifications:

    • Examine how stress conditions or growth phases affect modification patterns

    • Identify kinases, glycosyltransferases, or other enzymes responsible for the modifications

This methodological approach allows researchers to determine which modifications are essential for ROT1 function and how they contribute to its regulatory mechanisms.

What evolutionary insights can be gained from comparative analysis of ROT1 across fungal species?

Comparative genomics of ROT1 across fungal species provides valuable insights into its evolution and functional conservation:

Methodological Approach:

  • Identify ROT1 homologs across diverse fungal species using sequence similarity searches

  • Perform multiple sequence alignment to identify:

    • Highly conserved domains (likely functional core regions)

    • Variable regions (potential species-specific adaptations)

    • Lineage-specific insertions or deletions

  • Construct a phylogenetic tree to visualize evolutionary relationships

  • Map known functional information onto the alignment to predict structure-function relationships

Expected Findings:

Fungal GroupExpected Conservation LevelPotential Adaptations
Close relatives of A. gossypii (Saccharomycetaceae)High sequence conservationMinor adaptations to growth patterns
Other filamentous ascomycetesModerate conservation of functional domainsAdaptations to different hyphal growth patterns
Distant fungal lineagesConservation limited to key functional motifsSignificant divergence in regulatory domains

This comparative approach can guide the design of domain-swapping experiments to determine which regions confer specific functions or species-specific properties.

How can fluorescent protein fusions be optimized to study ROT1 dynamics in living Ashbya gossypii cells?

Live-cell imaging of ROT1 provides valuable insights into its localization and dynamics but requires careful optimization due to its membrane protein nature:

Optimization Protocol:

  • Tag position selection:

    • Create both N- and C-terminal fusions to determine which preserves function

    • Consider internal tagging at predicted loops for membrane proteins

    • Validate each construct by complementation testing in rot1 mutants

  • Fluorescent protein selection:

    • Use monomeric variants to prevent aggregation (e.g., mNeonGreen, mScarlet)

    • Consider photoconvertible proteins (e.g., mEos) for pulse-chase experiments

    • For membrane proteins, superfolder GFP often shows improved folding

  • Expression level control:

    • Use the native promoter when possible to maintain physiological levels

    • If needed, employ regulatable promoters with careful titration

    • Consider knock-in approaches to maintain native regulation

  • Imaging optimization:

    • Use spinning disk confocal microscopy for reduced photobleaching

    • Implement deconvolution algorithms for improved signal-to-noise ratio

    • For dynamic studies, optimize acquisition intervals to capture relevant timescales

These methodological considerations ensure that fluorescent protein fusions accurately reflect native ROT1 behavior while providing sufficient signal for analysis.

What roles might ROT1 play in the regulation of riboflavin production in Ashbya gossypii?

A. gossypii is known for its natural ability to overproduce riboflavin, particularly during the productive phase when active growth finishes . ROT1, as a cell wall protein, might influence this process through several mechanisms:

Potential Mechanisms and Research Approaches:

  • Stress Signaling Connection:

    • Cell wall integrity pathways often connect to metabolic regulation

    • Investigate whether ROT1 depletion affects riboflavin production

    • Analyze if ROT1 interacts with components of stress response pathways that influence metabolism

  • Growth Phase Transition Role:

    • The transition from trophic to productive phase involves significant cellular remodeling

    • Determine if ROT1 expression or modification changes during this transition

    • Test whether conditional ROT1 mutants show altered timing of the phase transition

  • Metabolic Pathway Interaction:

    • Examine potential connections between ROT1 and purine biosynthesis, which is linked to riboflavin production

    • Investigate whether ROT1 affects the localization or activity of enzymes involved in riboflavin biosynthesis

    • Analyze metabolomic changes in ROT1 mutants focusing on riboflavin precursors

This research direction could provide valuable insights into the interconnection between cell structure and specialized metabolism in A. gossypii.

How can synthetic biology approaches incorporate ROT1 for engineering improved Ashbya gossypii strains?

Synthetic biology offers powerful tools for enhancing A. gossypii strains for research or biotechnological applications:

Synthetic Biology Strategies:

  • Engineered Protein Scaffolds:

    • Create synthetic interaction domains within ROT1 to recruit and organize metabolic enzymes

    • Design scaffold systems that enhance enzyme proximity for improved metabolic flux

    • Validate designs using proteomic and metabolomic approaches

  • Conditional Expression Systems:

    • Develop synthetic genetic circuits that modulate ROT1 expression in response to specific signals

    • Create feedback systems linking ROT1 levels to metabolic outputs

    • Test circuit designs using fluorescent reporters before implementation

  • Domain Swapping:

    • Replace domains of ROT1 with functional equivalents from other organisms

    • Engineer chimeric proteins with novel properties

    • Screen libraries of chimeric constructs for enhanced performance

  • Protein Engineering:

    • Use directed evolution to optimize ROT1 for specific functions

    • Apply computational design to predict mutations that enhance desired properties

    • Validate engineered variants through comprehensive phenotypic characterization

These synthetic biology approaches can contribute to both fundamental understanding of ROT1 function and practical applications in strain improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.