Recombinant Ashbya gossypii Protein SYM1 (SYM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SYM1; AFR120C; Protein SYM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
SYM1
Target Protein Sequence
MSSFFKFYKASLQSHPKRTNALTTGFLFGLGDIVAQTQFPEPGASYDPMRTLRPFLYGAV LFSLVGDKWYRFLSTVRLGRLPQAHWANVLARVACDQLIFAPIGVPLYYTAMALMEGGSL EDVRIRLSEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLLTVNVLSIFWNTYLSYSNSTA SS
Uniprot No.

Target Background

Function
This protein may be involved in cellular stress response and is essential for maintaining mitochondrial DNA (mtDNA) integrity and stability.
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it used for recombinant protein production?

Ashbya gossypii is a filamentous fungus belonging to the Saccharomycete family that naturally overproduces riboflavin (vitamin B2). This organism has gained attention as a promising host for recombinant protein production due to several advantageous characteristics. A. gossypii shares close evolutionary ties with unicellular yeasts such as Saccharomyces cerevisiae, with approximately 95% of its protein-encoding genes having S. cerevisiae homologs, and about 90% of these arranged in a conserved, syntenic gene order . This genetic similarity facilitates the application of well-established yeast genetic manipulation techniques to A. gossypii. The completed genome sequence of A. gossypii has enabled more sophisticated genetic engineering approaches, making it particularly suitable for protein expression studies . Its filamentous growth pattern provides advantages for certain industrial applications compared to unicellular yeasts, while still maintaining relatively straightforward genetic manipulation protocols .

What is known about the protein secretory pathway in Ashbya gossypii?

Genome-wide analyses of A. gossypii have provided significant insights into its secretome and transcriptional responses during protein secretion stress. Studies indicate that approximately 1-4% of A. gossypii proteins are likely to be secreted, with less than 33% of these being putative hydrolases . Characterization of secreted proteins through two-dimensional gel electrophoresis has revealed that most A. gossypii secreted proteins have an isoelectric point between 4 and 6, and a molecular mass above 25 kDa . This information provides valuable reference points for predicting the physical properties of recombinant proteins targeted for secretion. Interestingly, transcriptomic analyses of A. gossypii under recombinant protein secretion conditions and dithiothreitol-induced secretion stress showed that, unlike many other eukaryotes, a conventional unfolded protein response (UPR) was not activated . Expression levels of several well-known UPR target genes (e.g., IRE1, KAR2, HAC1, and PDI1 homologs) remained unaffected under conditions that typically trigger this response . Instead, A. gossypii upregulates several genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, vesicle trafficking, and secretion pathways through alternative mechanisms .

What are the key regulatory mechanisms affecting heterologous protein expression in A. gossypii?

Several important regulatory mechanisms have been identified that significantly impact heterologous protein expression in A. gossypii. Transcriptional regulation in A. gossypii involves key factors such as SFL1 and FLO8, which influence growth and gene expression patterns . Deletion studies have shown that SFL1 acts as a suppressor of certain genes, while both SFL1 and FLO8 deletion mutants exhibit reduced growth . This suggests a complex regulatory network that balances growth requirements with gene expression. The transcription factor TEC1 has been identified as particularly important, regulating the expression of specific genes including FIG2 . The conservation of Tec1-binding sites between A. gossypii and S. cerevisiae, despite differences in their target genes, highlights evolutionary conservation of regulatory mechanisms that can be leveraged for expression optimization .

At the post-transcriptional level, A. gossypii demonstrates unique responses to secretion stress that differ from conventional eukaryotic systems. Rather than activating the canonical unfolded protein response, A. gossypii upregulates genes involved in alternative pathways for handling misfolded proteins, including protein degradation and mRNA processing mechanisms . Understanding these distinctive regulatory features is essential for designing effective expression strategies for heterologous proteins in this organism.

What molecular tools are available for expressing recombinant proteins in A. gossypii?

The genetic tractability of A. gossypii has facilitated the development of various molecular tools for recombinant protein expression. Building on its close relationship with S. cerevisiae, many genetic manipulation techniques have been adapted for A. gossypii. These include effective transformation protocols, selectable markers, and expression vectors with compatible promoters and terminators . The filamentous growth pattern of A. gossypii requires specific considerations in molecular tool design, particularly for protein secretion and culture homogeneity.

Homologous recombination techniques work efficiently in A. gossypii, enabling precise genome integration and modification . PCR-based gene targeting methods have been successfully implemented, allowing for targeted gene deletions, promoter replacements, and protein tagging. More recently, CRISPR/Cas9 genome editing systems have been adapted for use in filamentous fungi including A. gossypii, expanding the toolkit for precise genetic modifications . For protein expression studies, researchers have developed both constitutive and inducible promoter systems, offering flexibility in expression timing and strength. Additionally, various signal peptides have been characterized for directing proteins to the secretory pathway, which is particularly relevant for secreted proteins like SYM1.

How can the secretion stress response in A. gossypii be optimized for improved SYM1 expression?

Optimizing the secretion stress response in A. gossypii requires strategies that account for its unique stress response mechanisms. Unlike many eukaryotic expression systems, A. gossypii does not activate a conventional unfolded protein response (UPR) during secretion stress . Instead, it regulates several other genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, and secretion pathways . To enhance SYM1 expression, researchers should consider modulating these alternative stress response pathways rather than focusing on the canonical UPR elements.

Transcriptomic data reveals that under dithiothreitol-induced secretion stress, A. gossypii upregulates genes involved in protein unfolding, proteolysis, vesicle trafficking, and mRNA degradation . Strategic engineering of these pathways, such as overexpressing beneficial components of the vesicle trafficking machinery or reducing the activity of specific proteases, may improve recombinant protein yields. Additionally, transcriptomic analysis shows that secretion stress causes severe repression of genes encoding secretory proteins, including components of the glycosylation pathway . This suggests that managing glycosylation stress could be a critical factor in optimizing expression. Developing strains with enhanced capacity for proper protein folding, potentially through the overexpression of specific chaperones identified in the A. gossypii stress response, offers another promising approach. Importantly, experimental designs should systematically evaluate these strategies, as the unconventional stress response in A. gossypii means that approaches effective in other systems may not translate directly.

What analytical methods are most effective for characterizing SYM1 protein expressed in A. gossypii?

Characterization of recombinant proteins from A. gossypii requires a comprehensive analytical approach combining both general protein analysis techniques and methods specific to fungal expression systems. Two-dimensional gel electrophoresis has proven effective for mapping proteins secreted by A. gossypii in both minimal and rich media, revealing characteristic patterns of secreted proteins with isoelectric points primarily between 4 and 6 and molecular masses above 25 kDa . This technique, combined with mass spectrometry, provides a powerful platform for identifying and quantifying SYM1 in the context of other secreted proteins.

As a eukaryotic system, A. gossypii may introduce post-translational modifications to recombinant proteins, necessitating specialized analytical methods. Glycoproteomics and advanced mass spectrometry techniques are essential for characterizing potential glycosylation patterns. Functional assays specific to SYM1 should be developed to determine if the protein produced in A. gossypii maintains its biological activity, with these assays calibrated against reference standards when available. Structural analysis using techniques such as circular dichroism spectroscopy or X-ray crystallography can provide insights into whether the recombinant protein maintains its native conformation. For research applications requiring high purity, developing sensitive assays to detect A. gossypii-derived host cell proteins is crucial. The selection of analytical methods should be guided by the specific research questions being addressed and the intended applications of the recombinant SYM1 protein.

How do growth conditions affect SYM1 production and what parameters should be optimized?

Growth conditions significantly impact recombinant protein production in A. gossypii, with several key parameters requiring optimization for maximum SYM1 yield and quality. Medium composition represents a critical factor, as A. gossypii has been successfully cultured in both minimal and rich media for protein secretion studies . The choice of carbon sources, nitrogen sources, and specific nutrient supplements can dramatically affect both growth and protein expression patterns. Monitoring growth phases in A. gossypii requires specific approaches due to its filamentous morphology, which differs fundamentally from unicellular yeasts. Optimizing induction timing based on growth phase is essential for maximizing protein yield, particularly when using inducible promoter systems.

The filamentous growth of A. gossypii creates unique challenges for bioreactor cultivation, as the resulting high viscosity can limit oxygen transfer . Optimizing agitation, aeration, and bioreactor design parameters is crucial for maintaining proper dissolved oxygen levels without causing excessive shear stress to the mycelium. pH control represents another critical factor, particularly considering that A. gossypii secretes proteins with isoelectric points primarily between 4 and 6 . Maintaining an appropriate pH balance that supports optimal growth while ensuring protein stability is essential for maximizing SYM1 yield. Temperature profiles should be carefully optimized, potentially implementing temperature shift strategies that balance growth rate with proper protein folding, especially given the unique stress response mechanisms in A. gossypii. Systematic optimization of these parameters using design of experiments (DoE) approaches is recommended to identify the optimal conditions for SYM1 production.

What are the most common challenges in expressing SYM1 in A. gossypii and how can they be addressed?

Researchers working with recombinant protein expression in A. gossypii frequently encounter several significant challenges. Low secretion yield remains a primary concern, as studies indicate that only 1-4% of A. gossypii proteins are naturally secreted . To address this limitation, researchers can implement several strategies: optimizing signal peptides specifically for A. gossypii secretion pathways, engineering strains with enhanced secretory capacity, selecting high-copy integration sites, and implementing fed-batch cultivation strategies to extend the production phase.

Protein degradation presents another common challenge, as A. gossypii upregulates proteolysis pathways under secretion stress conditions . Effective approaches to mitigate degradation include developing protease-deficient strains through genetic engineering, adding appropriate protease inhibitors to culture media, optimizing harvest timing to minimize exposure to proteases, and potentially engineering more stable protein variants. The filamentous morphology of A. gossypii introduces unique challenges related to culture heterogeneity and mixing efficiency. Researchers can address these issues by optimizing media composition to influence morphology, adjusting bioreactor design and operating parameters for filamentous growth, and developing strains with modified morphology more suitable for protein production. Post-translational modifications, particularly glycosylation, may affect protein function and stability. Characterizing the modifications produced by A. gossypii and potentially engineering the glycosylation pathway may be necessary for optimal protein activity. Each challenge requires a systematic troubleshooting approach, often combining genetic, process, and analytical solutions tailored to the specific properties of SYM1.

How can transcriptomic and proteomic data be integrated to resolve expression bottlenecks for SYM1 in A. gossypii?

Integrating transcriptomic and proteomic data provides a powerful systems biology approach to identify and resolve expression bottlenecks for recombinant proteins in A. gossypii. A comprehensive experimental design should collect samples at multiple time points during SYM1 expression, performing RNA sequencing to capture transcriptome-wide changes while simultaneously conducting both intracellular and secretome proteomics . This multi-omics approach enables correlation analysis between transcript and protein levels for secretory pathway components, pathway enrichment analysis to identify activated or repressed processes, and time-course analysis to detect sequential changes in gene expression and protein levels.

Through this integrated analysis, researchers can identify specific bottleneck categories: transcriptional limitations (indicated by low transcript levels despite strong promoters), translational limitations (high transcript but low intracellular protein levels), folding limitations (increased expression of chaperones and folding factors), secretion limitations (protein accumulation in the cell despite high expression), and post-secretion limitations (degradation in the culture medium) . Each identified bottleneck category suggests specific intervention strategies. For transcriptional bottlenecks, promoter engineering or transcription factor modulation may be effective. Translational bottlenecks might be addressed through codon optimization. Folding bottlenecks could be alleviated by co-expressing relevant chaperones. Secretion bottlenecks might require engineering of secretory pathway components. Degradation bottlenecks may necessitate protease gene deletion or inhibition. This integrated approach leverages the comprehensive view provided by multiple data types to develop more effective and targeted optimization strategies tailored to the specific challenges encountered with SYM1 expression.

What experimental design would you recommend for optimizing SYM1 purification from A. gossypii culture supernatants?

Developing an effective purification process for SYM1 from A. gossypii culture supernatants requires a systematic experimental approach. The initial characterization phase should determine SYM1's physical properties (size, isoelectric point, hydrophobicity) and analyze culture supernatant composition to identify major contaminants. Two-dimensional gel electrophoresis has been successfully used to characterize A. gossypii secreted proteins, revealing that most have isoelectric points between 4 and 6 and molecular masses above 25 kDa . This information provides an essential foundation for developing effective purification strategies.

How should contradictory results in SYM1 expression studies be interpreted and resolved?

When researchers encounter contradictory results in recombinant protein expression studies with A. gossypii, a systematic approach to interpretation and resolution is essential. First, categorize the nature of contradictions, whether they involve expression level discrepancies, functional activity differences, physical property variations, or reproducibility issues. Then conduct a systematic source analysis considering strain-related factors (genetic drift, mutation accumulation), process-related factors (variation in cultivation conditions, media components), analytical method limitations (assay sensitivity or interference), and experimental design issues (inadequate controls or confounding variables).

Resolution strategies should include experimental reproduction with standardized protocols, cross-laboratory validation using identical materials, implementation of more robust analytical methods, and systematic variation of individual parameters to identify sources of variability. Statistical approaches such as meta-analysis of multiple datasets, outlier detection, regression analysis to identify key variables affecting outcomes, and variance component analysis can quantify sources of variability . For advanced troubleshooting, consider deep sequencing of production strains to detect genetic variations, proteomics analysis to identify potential interacting partners, and in-depth product characterization to identify subtle differences. This structured approach helps distinguish between true biological variability and technical artifacts, leading to more robust and reproducible expression systems for SYM1 production.

What statistical approaches are recommended for analyzing the impact of multiple variables on SYM1 expression in A. gossypii?

When analyzing the impact of multiple variables on recombinant protein expression in A. gossypii, several statistical approaches are particularly valuable. Design of Experiments (DoE) methodologies, including factorial designs, response surface methodology, and Taguchi methods, allow for systematic screening and optimization of multiple factors simultaneously. These approaches are particularly useful given the complex interplay of factors affecting protein production in filamentous fungi.

Multivariate data analysis techniques such as Principal Component Analysis (PCA) and Partial Least Squares (PLS) regression can identify patterns in complex datasets and model relationships between process parameters and protein expression . Time-series analysis methods are especially relevant for A. gossypii cultivation, enabling modeling of growth curves, time-course expression profiles, and detection of critical transitions during the production process. Variance analysis approaches, including ANOVA, MANOVA, and mixed effects models, can compare multiple conditions while accounting for both random and fixed factors. Process modeling using empirical models, mechanistic models, or hybrid approaches can relate process parameters to expression outcomes and predict optimal conditions for SYM1 production. The selection of appropriate statistical methods should be guided by the specific experimental design, the nature of the variables being studied, and the research questions being addressed.

How might systems biology approaches contribute to a better understanding of SYM1 expression in A. gossypii?

Systems biology offers comprehensive frameworks for understanding the complex interplay of factors affecting recombinant protein production in A. gossypii. Multi-omics integration combining genomics, transcriptomics, proteomics, and metabolomics can provide a holistic view of cellular processes during SYM1 production . Network analysis approaches, including regulatory network reconstruction, protein-protein interaction mapping, and metabolic network analysis, can identify key nodes and regulatory hubs that influence protein expression and secretion pathways.

Constraint-based modeling using genome-scale metabolic models of A. gossypii enables flux balance analysis to predict optimal production conditions and resource allocation models for protein synthesis. Dynamic modeling approaches incorporating kinetic models of key pathways and spatial models of protein secretion in filamentous organisms can capture the unique aspects of protein production in A. gossypii . Comparative systems biology, contrasting A. gossypii with other protein production hosts, can identify conserved and divergent regulatory mechanisms, potentially revealing unique advantages of this expression system. These systems biology approaches provide a more holistic understanding of protein production in A. gossypii, leading to more rational and effective optimization strategies for SYM1 expression.

How can synthetic biology approaches be applied to engineer novel functionalities into SYM1 expressed in A. gossypii?

Synthetic biology offers powerful approaches for engineering novel functionalities into recombinant proteins expressed in A. gossypii. Protein domain engineering through fusion of functional domains from other proteins can create chimeric proteins with novel activities. The rational design of linker regions between domains can optimize spatial arrangement and flexibility. Directed evolution techniques can generate SYM1 variants with enhanced or altered functions tailored to specific research or application needs.

Regulatory circuit design approaches, including development of synthetic promoters responsive to specific signals and engineered riboswitches for post-transcriptional regulation, can provide precise control over SYM1 expression . Metabolic integration strategies can couple SYM1 expression to metabolic sensors or synthetic metabolic pathways. Multi-protein complex engineering through co-expression of interaction partners can create functional protein assemblies with enhanced or novel properties. Genome-scale engineering approaches, including minimization of the A. gossypii genome to create streamlined expression hosts, can optimize cellular resources for recombinant protein production. These synthetic biology approaches leverage A. gossypii's genetic tractability and the growing toolkit of genetic parts designed specifically for filamentous fungi, opening new possibilities for SYM1 engineering and application.

What emerging technologies have the potential to revolutionize SYM1 expression and purification from A. gossypii?

Several emerging technologies show promise for transforming recombinant protein production in A. gossypii. Advanced genetic tools, including CRISPR-Cas systems optimized for filamentous fungi and site-specific recombination systems, enable precise genetic manipulation with unprecedented efficiency . High-throughput screening technologies, such as microfluidic cultivation systems and droplet-based screening platforms, facilitate rapid evaluation of multiple strain variants and cultivation conditions.

Process intensification approaches, including continuous bioprocessing and perfusion systems, can significantly increase volumetric productivity while reducing costs. Advanced purification technologies, such as continuous chromatography systems and affinity-based capture using engineered binding proteins, offer improvements in both efficiency and selectivity. Computational approaches leveraging machine learning for process parameter optimization and in silico protein design can accelerate development cycles. Advanced analytical technologies, including single-cell proteomics for population heterogeneity analysis and real-time metabolomics for process monitoring, provide deeper insights into protein production dynamics. Integration of these emerging technologies into A. gossypii research programs could significantly enhance the efficiency and capabilities of recombinant protein production systems, making A. gossypii an increasingly attractive platform for SYM1 expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.