Recombinant Ashbya gossypii Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Functional Role in ER Morphology

YOP1 stabilizes high-curvature regions of the ER tubules through two mechanisms:

  • Wedge Model: Hydrophobic hairpins penetrate the outer ER membrane leaflet, inducing curvature by creating asymmetry in lipid packing .

  • Oligomerization: Forms arc-like oligomers that scaffold the tubular ER without obstructing protein diffusion .

This dual mechanism ensures ER structural stability while permitting plasticity for transport and signaling .

Biotechnological Applications

While A. gossypii is industrially used for riboflavin production , its potential as a host for recombinant proteins like YOP1 is emerging:

  • Expression Systems: Recombinant YOP1 is typically produced in Escherichia coli or yeast systems .

  • Secretion Challenges: A. gossypii secretes recombinant proteins at low levels compared to Saccharomyces cerevisiae, though promoter optimization (e.g., AgTEF, AgGPD) can enhance yields .

Research Gaps and Future Directions

  • Limited Direct Studies: Most research on YOP1 focuses on homologs like mammalian REEP1 or yeast Yop1p . Direct studies on A. gossypii YOP1 are sparse.

  • Disease Relevance: Mutations in human REEP1 (a YOP1 homolog) cause hereditary spastic paraplegia , suggesting recombinant YOP1 could model ER-related neurological disorders.

Comparative Analysis of YOP1 Homologs

OrganismProteinFunctionDisease Association
Ashbya gossypiiYOP1ER tubule stabilizationNone reported
Homo sapiensREEP1ER shaping, odorant receptor traffickingHereditary spastic paraplegia
Saccharomyces cerevisiaeYop1pER and nuclear membrane morphologyNone

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
YOP1; ADR063W; Protein YOP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
YOP1
Target Protein Sequence
MAEIAGNLQRILQSLDRQQFAGNKYLQEFERKTGFPKSYAIAGAGVAYLFIIFINVGGVG EILSNFLGFVLPCYYSLHAIKTTTTADDTELLTYWIVFAFFSVIEFWSKAILYWVPFYWF FKTIFLIFIALPQLGGASLIYHRVIAPLTDPYIAAGSQRKASGISSKMEQAAKGASARAT GAASHQSSD
Uniprot No.

Target Background

Function
Involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Ashbya gossypii relate to other model organisms in fungal biology?

Ashbya gossypii is a filamentous Saccharomycete that has gained significance in biotechnology as an industrial producer of riboflavin. Despite its filamentous morphology, A. gossypii is phylogenetically closer to yeasts than to other filamentous fungi, sharing a high degree of gene homology and gene order conservation with the budding yeast Saccharomyces cerevisiae . This evolutionary relationship makes A. gossypii an interesting model organism at the interface between unicellular and multicellular fungal biology.

A. gossypii possesses one of the smallest eukaryotic genomes known, with 4,776 annotated open reading frames . This compact genome and the organism's phylogenetic position provide unique opportunities for comparative genomic studies and for understanding the evolution of protein function across fungal species.

What is the predicted structural organization of YOP1?

Based on the amino acid sequence, YOP1 is predicted to contain multiple hydrophobic regions that likely form transmembrane domains. The protein contains regions rich in hydrophobic amino acids (such as phenylalanine, leucine, and isoleucine) interspersed with charged residues that could anchor the protein in cellular membranes .

The sequence "VAYLFIIFINVGGVGEILSNFLGFVLPCYYSLH" and similar hydrophobic stretches suggest transmembrane domains typical of proteins involved in membrane organization. The hydrophilic regions are likely exposed to either the cytoplasm or the lumen of the organelle where YOP1 resides.

What expression systems are suitable for producing recombinant Ashbya gossypii YOP1?

Recombinant YOP1 can be produced using several expression systems, with each offering distinct advantages:

  • Bacterial systems (E. coli): While cost-effective and scalable, membrane proteins like YOP1 may form inclusion bodies, requiring refolding protocols.

  • Yeast expression systems (S. cerevisiae or P. pastoris): These provide a eukaryotic environment with proper folding machinery and post-translational modifications. Given A. gossypii's close phylogenetic relationship to yeast, S. cerevisiae may be particularly suitable .

  • Filamentous fungal hosts: A. gossypii itself or other filamentous fungi could be used for homologous or heterologous expression, respectively.

When selecting an expression system, researchers should consider:

  • The requirement for post-translational modifications

  • The need for proper folding of membrane domains

  • The desired yield and purity

  • Compatibility with downstream applications

How does the secretory pathway in Ashbya gossypii affect recombinant protein production?

A. gossypii has a unique secretory pathway that differs from both yeasts and other filamentous fungi. Genome-wide analyses indicate that only 1-4% of A. gossypii proteins are likely to be secreted, with less than 33% of these being putative hydrolases . This secretory capacity is more similar to yeast than to other filamentous fungi, which typically have more robust secretion systems.

Interestingly, A. gossypii does not appear to activate a conventional unfolded protein response (UPR) under secretion stress conditions. When subjected to dithiothreitol (DTT)-induced secretion stress or during recombinant protein expression, the expression levels of several well-known UPR target genes (e.g., IRE1, KAR2, HAC1, and PDI1 homologs) remained unaffected . Instead, the fungus employs alternative mechanisms to cope with secretion stress, including:

  • Up-regulation of genes involved in:

    • Protein unfolding

    • Endoplasmic reticulum-associated degradation

    • Proteolysis

    • Vesicle trafficking

    • Vacuolar protein sorting

    • mRNA degradation

  • Down-regulation of genes encoding:

    • Secretory proteins

    • Components of the glycosylation pathway

This distinctive response to secretion stress should be considered when designing expression strategies for recombinant YOP1 in A. gossypii or when using the protein in experimental systems.

What purification strategies are effective for isolating recombinant YOP1?

Purification of recombinant YOP1 typically requires a multi-step approach, especially given its membrane protein characteristics:

  • Affinity Chromatography: Using a fusion tag (His, GST, etc.) can facilitate initial capture. Available recombinant YOP1 preparations may include various tag types determined during the production process .

  • Detergent Solubilization: As YOP1 is likely membrane-associated, appropriate detergents are essential for solubilization while maintaining native conformation.

  • Size Exclusion Chromatography: This can separate properly folded YOP1 from aggregates and other impurities.

  • Ion Exchange Chromatography: Since most A. gossypii secreted proteins have an isoelectric point between 4 and 6 , cation exchange at appropriate pH could be effective for YOP1 purification.

Storage of purified YOP1 should follow established protocols, such as maintaining the protein in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week.

What analytical techniques are most suitable for studying YOP1 structure and interactions?

Multiple complementary techniques can be employed to investigate YOP1:

  • Structural Analysis:

    • Circular Dichroism (CD): To analyze secondary structure composition

    • NMR Spectroscopy: For detailed structural information of solubilized protein

    • Cryo-Electron Microscopy: Particularly useful for membrane proteins in lipid environments

  • Interaction Studies:

    • Co-immunoprecipitation: To identify interacting partners

    • Yeast Two-Hybrid Analysis: For protein-protein interaction mapping, though may have limitations for membrane proteins

    • Crosslinking Mass Spectrometry: To capture transient or weak interactions

  • Localization:

    • Fluorescence Microscopy: Using tagged versions of YOP1

    • Immunoelectron Microscopy: For high-resolution localization

  • Functional Assays:

    • Membrane Remodeling Assays: To assess effects on membrane curvature

    • Liposome Tubulation Assays: To evaluate membrane deformation capabilities

How can researchers design experiments to assess YOP1's role in secretion stress response?

Given A. gossypii's unique secretion stress response that doesn't follow the conventional UPR pathway , investigating YOP1's role requires tailored experimental designs:

  • Stress Induction Protocol:

    • Use dithiothreitol (DTT) at appropriate concentrations to induce secretion stress

    • Monitor growth rates during stress conditions (significant reduction was observed after 1 hour of DTT treatment)

  • Transcriptomic Analysis:

    • Compare expression profiles of wild-type and YOP1-deleted strains under stress

    • Focus on genes involved in alternative stress response pathways identified in A. gossypii:

      • Protein unfolding mechanisms

      • ER-associated degradation

      • Vesicle trafficking

      • mRNA degradation

  • Protein Secretion Assays:

    • Quantify secreted protein profiles using 2D gel electrophoresis under various conditions

    • Compare secretion patterns between control and YOP1-modified strains

    • Note that most A. gossypii secreted proteins have isoelectric points between 4 and 6, and molecular masses above 25 kDa

  • Co-expression Studies:

    • Express recombinant reporter proteins (like EGI used in previous studies) alongside modified YOP1 levels

    • Assess how YOP1 modifications affect the secretion efficiency and stress response

How might YOP1 contribute to A. gossypii's unique secretory pathway characteristics?

A. gossypii demonstrates secretion stress responses distinct from conventional UPR pathways seen in other fungi . YOP1, as a potential membrane-organizing protein, could play critical roles in this alternative response mechanism through:

  • Membrane Remodeling: YOP1 might facilitate changes in ER morphology during stress adaptation, potentially compensating for the lack of conventional UPR.

  • Vesicle Trafficking Regulation: The protein could influence the distribution and function of secretory vesicles, affecting protein transport efficiency.

  • Organelle Contact Sites: YOP1 might participate in forming or regulating membrane contact sites between the ER and other organelles, facilitating inter-organelle communication during stress.

An experimental approach to investigate these possibilities would involve combinations of:

  • Electron microscopy to visualize membrane architecture changes

  • Live-cell imaging of fluorescently tagged YOP1 and organelle markers

  • Proximity labeling techniques to identify proteins near YOP1 during normal and stress conditions

What comparative genomic approaches could reveal insights about YOP1 evolution and function?

Given A. gossypii's phylogenetic position between yeasts and filamentous fungi, comparative analyses of YOP1 could reveal evolutionary adaptations in secretory pathways:

  • Sequence Comparison Analysis:

    • Align YOP1 sequences from diverse fungi, focusing on conserved and divergent regions

    • Identify clade-specific features that might correspond to morphological differences

    • Correlate sequence variations with differences in secretory pathway organization

  • Complementation Studies:

    • Express A. gossypii YOP1 in S. cerevisiae YOP1 deletion strains to assess functional conservation

    • Test whether YOP1 from filamentous fungi can complement A. gossypii YOP1 functions

  • Domain Function Analysis:

    • Create chimeric proteins with domains from YOP1 homologs of different species

    • Map functional differences to specific protein regions

Such studies could help understand how secretory pathway proteins evolved during the transition from unicellular to multicellular fungal forms.

What methodological approaches could elucidate YOP1's role in membrane biology?

Advanced techniques for investigating YOP1's membrane-related functions include:

  • In vitro Membrane Remodeling Assays:

    • Reconstitute purified YOP1 in artificial liposomes

    • Measure membrane curvature induction using electron microscopy

    • Assess lipid specificity through varied liposome compositions

  • Super-resolution Microscopy:

    • Use techniques like STORM or PALM to visualize YOP1 distribution at nanoscale resolution

    • Perform two-color imaging with other organelle markers to map precise localization

  • Micro-scale Thermophoresis (MST):

    • Measure interactions between YOP1 and lipids or other proteins

    • Determine binding affinities and kinetics in near-native conditions

  • Cryo-Electron Tomography:

    • Visualize cellular ultrastructure with YOP1 immunogold labeling

    • Map YOP1 distribution in relation to membrane curvature and organelle morphology

The implementation of these techniques could reveal how YOP1 physically interacts with membranes and contributes to organelle architecture.

What controls should be included when working with recombinant YOP1?

Rigorous experimental design requires appropriate controls when studying recombinant YOP1:

  • Expression Controls:

    • Empty vector controls in the same expression system

    • Expression of an unrelated protein of similar size/properties

    • Expression of YOP1 homologs from related organisms

  • Purification Controls:

    • Mock purification from host cells without YOP1 expression

    • Purification of a well-characterized control protein using identical methods

  • Functional Assays:

    • Heat-denatured YOP1 as a negative control

    • YOP1 with site-directed mutations in key residues

    • Treatment with specific inhibitors of predicted activities

  • Stress Response Studies:

    • Parallel analysis of known UPR components (IRE1, KAR2, HAC1, PDI1)

    • Inclusion of positive controls for stress induction (DTT treatment should affect expression of specific genes)

These controls help distinguish specific YOP1 effects from experimental artifacts or general stress responses.

How should researchers interpret secretion stress data in A. gossypii compared to other fungi?

When analyzing secretion stress in A. gossypii, researchers should consider its unique response patterns:

  • UPR Marker Interpretation:

    • Unlike in S. cerevisiae and other fungi, traditional UPR markers (IRE1, KAR2, HAC1, PDI1) may not show expression changes during secretion stress

    • Focus instead on alternative response genes identified in A. gossypii (involved in protein unfolding, ERAD, proteolysis, vesicle trafficking)

  • Growth Analysis:

    • DTT treatment causes reduction in growth rate in A. gossypii

    • This effect may correlate with down-regulation of genes involved in filamentous growth, glycosylation, and lipoprotein biosynthesis

  • Transcriptional Response Timeline:

    • Some responses occur within 30 minutes of stress induction (down-regulation of growth-related genes)

    • Other responses, like down-regulation of ribosomal protein genes, become more pronounced after 1 hour

Table 1: Comparison of Secretion Stress Responses Between A. gossypii and S. cerevisiae

Response ElementA. gossypiiS. cerevisiae
UPR ActivationNot observedStrong activation
HAC1 SplicingNot detectedPrimary UPR mechanism
Ribosomal GenesDown-regulated after 1hDown-regulated
Growth RateReducedReduced
Glycosylation GenesDown-regulatedVariable response
Alternative MechanismsUp-regulation of protein unfolding, ERAD, proteolysis genesLess prominent

This table highlights the need for fungi-specific interpretations of secretion stress data rather than assuming conserved responses across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.