Recombinant Ashbya gossypii Protoheme IX farnesyltransferase, mitochondrial (COX10)

Shipped with Ice Packs
In Stock

Description

Table 1: Physical and Chemical Properties

PropertyDetails
Expression SystemEscherichia coli or yeast
TagHis-tag or GST-tag (varies by product)
Purity≥85% (SDS-PAGE verified)
Storage-20°C (long-term); 4°C for working aliquots
StabilitySensitive to repeated freeze-thaw cycles

Biological Role in Heme Biosynthesis

COX10 catalyzes the first step in heme A synthesis:

Protoheme IX + Farnesyl diphosphateCOX10Heme O + Pyrophosphate\text{Protoheme IX + Farnesyl diphosphate} \xrightarrow{\text{COX10}} \text{Heme O + Pyrophosphate}

This reaction is indispensable for COX maturation, enabling electron transfer in oxidative phosphorylation . Mutations in human COX10 are linked to mitochondrial disorders like Leigh syndrome and cardiomyopathy due to COX deficiency .

Disease Modeling

Recombinant A. gossypii COX10 is used to study COX-associated pathologies. For example:

  • Complementation Assays: Restores COX activity in patient-derived fibroblasts with COX10 mutations .

  • Enzyme Kinetics: Measures farnesyltransferase activity in vitro to assess inhibitor efficacy .

Industrial and Biotechnological Uses

  • Riboflavin Production: A. gossypii is a industrial riboflavin producer; COX10 studies optimize metabolic pathways .

  • Antibody Development: Serves as an antigen for generating COX10-specific antibodies (e.g., CUSABio’s CSB-PA007188) .

Key Research Findings

  • Clinical Relevance: Over 20 pathogenic COX10 mutations are documented, causing phenotypes ranging from tubulopathy to fatal cardiomyopathy .

  • Structural Insights: Topological models based on prokaryotic orthologs identify catalytic residues (e.g., N204K substitution disrupts heme O synthesis) .

  • Evolutionary Conservation: A. gossypii COX10 shares synteny with Saccharomyces cerevisiae, aiding cross-species functional studies .

Challenges and Future Directions

  • Expression Optimization: Low yields in E. coli due to transmembrane domain complexity .

  • Therapeutic Potential: Gene therapy using recombinant COX10 to treat mitochondrial disorders remains exploratory .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX10; AAL115W; Protoheme IX farnesyltransferase, mitochondrial; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-435
Protein Length
Full Length of Mature Protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
Target Protein Sequence
LSKSSSKIAPAAALNTAPIEFTPNTSAASLHERSTVIKDAARSALRCNDTTPTPALPFDV KRVDKANRAAGRKLPAASGVLSAYALMGPYIQLAKPRLTVLVMLSAICSYALSPYPATVL ELLSLTVGTTLCSAAANGINMGREPDFDRQMMRTQARPVVRGLVTPMQAYKFSAVSGVIG TAILYAGVNPTVALLGASNIVLYSWFYTSLKRKHIINTWFGAITGAIPPLMGWAAASPLT HPGCWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGHVMTAWKNPKLNARVALRYSLLMFPL CFGLSYYGITDWTYQIDSALVNGWMSFWAFKFWWQQRYNYSKKVYNNKAEFNKGMVLANV YARKTFWVSVLHLPAVLILAIVHKKGRWDWLFSDEGKLVA
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of protoheme IX and farnesyl diphosphate to heme O.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is COX10 and what is its function in cellular metabolism?

COX10 (Protoheme IX farnesyltransferase) is an essential enzyme that catalyzes the first step in the mitochondrial heme A biosynthetic pathway. Specifically, COX10 converts protoheme (heme B) to heme O via farnesylation of a vinyl group at position C2 . This enzymatic function is critical because heme A serves as an essential cofactor for cytochrome c oxidase (COX), which is a key component of the mitochondrial electron transport chain (ETC) . The enzyme's function is highly conserved across species, including in model organisms like Ashbya gossypii and pathogenic organisms like Plasmodium falciparum, making it an important subject for both basic research and therapeutic targeting .

Research methodologies for studying COX10 function typically involve:

  • Genetic knockout or conditional knockdown of the COX10 gene

  • Complementation studies using viral vectors expressing functional COX10

  • Measurement of heme A content in isolated mitochondria

  • Analysis of COX enzyme activity and assembly in mutant cells

How does COX10 contribute to cytochrome c oxidase assembly in yeast systems?

In yeast systems such as Saccharomyces cerevisiae and Ashbya gossypii, COX10 plays a crucial role in the highly regulated process of cytochrome c oxidase assembly. The enzyme is part of a sequence of events that begins with Cox1 protein synthesis and proceeds through multiple assembly stages .

COX10's specific contribution includes:

  • Providing heme O, which is subsequently converted to heme A by Cox15

  • Supporting the insertion of heme A into Cox1, a process that may involve the assembly factor Shy1 (homolog of human SURF1)

  • Facilitating the transition from early to late assembly intermediates

The timing of heme A insertion is critical, as it appears to occur prior to the addition of other subunits like Cox5a/b (yeast nomenclature) and Cox6 . Evidence suggests that high-copy expression of COX10 can suppress respiratory defects in yeast strains lacking other assembly factors like Coa1, indicating functional relationships between these proteins in the assembly pathway .

What experimental methods are used to express and purify Ashbya gossypii COX10?

Expression and purification of Ashbya gossypii COX10 can be achieved through several methodological approaches:

Expression SystemAdvantagesConsiderationsTypical Purity
Cell-Free ExpressionRapid production, avoids toxicity issuesMay have lower yield≥85% by SDS-PAGE
E. coliCost-effective, scalableMay require codon optimization, potential for inclusion bodies≥85% by SDS-PAGE
Yeast (homologous)Proper folding, post-translational modificationsSlower growth, more complex media requirements≥85% by SDS-PAGE
BaculovirusEukaryotic processing, high yield for membrane proteinsHigher cost, longer production time≥85% by SDS-PAGE
Mammalian CellsMost native-like post-translational modificationsHighest cost, complex media, slower growth≥85% by SDS-PAGE

Purification methods typically involve:

  • Cell lysis under conditions that maintain membrane protein integrity

  • Solubilization using appropriate detergents

  • Affinity chromatography (often using His-tags or other fusion tags)

  • Size exclusion chromatography for final purity

  • Quality assessment by SDS-PAGE and functional assays

When expressing COX10, researchers should consider its membrane-bound nature and the need to maintain proper folding for enzymatic activity.

How can COX10 mutants be generated and characterized to study mitochondrial disease mechanisms?

Generation and characterization of COX10 mutants provide valuable insights into mitochondrial disease mechanisms. Researchers can employ several sophisticated approaches:

Mutant Generation Methods:

  • Site-directed mutagenesis of conserved residues based on topological models and known patient mutations

  • CRISPR-Cas9 genome editing in model organisms or cell lines

  • Patient-derived cell lines carrying natural COX10 mutations

  • Random mutagenesis followed by selection for specific phenotypes

Characterization Methodologies:

  • Complementation studies using retroviral vectors expressing wild-type COX10 to rescue mutant phenotypes

  • Microcell-mediated chromosome transfer to assess genetic rescue

  • Quantitative analysis of heme A content in isolated mitochondria, correlated with:

    • COX enzyme activity measurements

    • Assessment of assembled enzyme complexes by blue native PAGE

    • Oxygen consumption rates in intact cells and isolated mitochondria

  • Evolutionary conservation analysis of mutated residues across species

  • Structure-function correlation using topological modeling of mutations relative to known catalytic domains

These approaches have revealed that different missense mutations in COX10 can lead to various clinical presentations, including Leigh Syndrome and hypertrophic cardiomyopathy, depending on their impact on enzyme function .

What role does COX10 play in Plasmodium falciparum, and how might it be exploited as an antimalarial target?

COX10 (PfCOX10) in Plasmodium falciparum serves as a promising antimalarial drug target due to its essential role in parasite metabolism:

Biological Significance:

  • PfCOX10 is critical for heme O synthesis in the parasite

  • Heme O is a necessary precursor to heme A, which functions as a cofactor for cytochromes in the mitochondrial electron transport chain (ETC)

  • The parasite's ETC is essential for pyrimidine biosynthesis and other vital processes

Research Methodologies:

  • Conditional knockdown of PfCOX10 using genetic techniques to validate it as a target

  • High-throughput screening approaches:

    • Screening compounds known to interact with heme

    • Testing candidate libraries such as the Pathogen Box collection from Medicines for Malaria Venture (MMV)

  • Structure-based drug design targeting conserved catalytic regions

  • Growth inhibition assays with parasites having reduced PfCOX10 expression

Research Findings:

  • Modest interaction between PfCOX10 and the antimalarial compound DSM1 has been identified

  • Several compounds from the MMV Pathogen Box show enhanced activity against parasites with reduced PfCOX10 levels

  • The essentiality of the heme A biosynthetic pathway makes it an attractive target for circumventing existing drug resistance mechanisms

This research direction represents a novel approach to antimalarial drug development that targets a different aspect of parasite metabolism than most current antimalarials.

How do genetic modifiers affect COX10 function and associated phenotypes?

The impact of COX10 mutations can be significantly influenced by genetic modifiers, leading to variable phenotypic presentations even with identical primary mutations:

Mechanisms of Modification:

  • Nuclear genetic modifiers can alter the severity of COX10-related mitochondrial dysfunction

  • Epigenetic phenomena may influence COX10 expression levels or the expression of interacting proteins

  • Environmental factors may trigger or ameliorate phenotypic manifestations of COX10 mutations

Research Approaches:

  • Whole genome or exome sequencing of patients with variable presentations of COX10 mutations

  • Analysis of gene expression profiles in affected tissues

  • Generation of model organisms with COX10 mutations on different genetic backgrounds

  • Identification of synthetic lethal or synthetic viable interactions with COX10 mutations

Clinical Significance:

  • COX10 mutations can manifest as diverse phenotypes ranging from infantile to adult-onset disease

  • Clinical presentations include:

    • Leigh Syndrome

    • Hypertrophic cardiomyopathy

    • Anemia

    • Sensorineural deafness

    • Complex multisystem mitochondrial disorders

This variability highlights the complex nature of mitochondrial disorders and suggests that personalized medicine approaches may be necessary for effective treatment strategies.

What are the optimal assay systems for measuring COX10 enzymatic activity?

Measuring COX10 enzymatic activity presents technical challenges due to its membrane-bound nature and integration with the mitochondrial heme biosynthesis pathway. Several methodological approaches are available:

Direct Enzymatic Assays:

  • Radiolabeled substrate incorporation assays using 14C-farnesyl pyrophosphate and protoheme IX

  • HPLC-based detection of heme O formation from protoheme IX and farnesyl pyrophosphate

  • Mass spectrometry analysis of heme conversion in reconstituted membrane systems

Indirect Activity Assessment:

  • Heme A quantification in isolated mitochondria using:

    • HPLC with diode array detection

    • Mass spectrometry

    • Spectrophotometric analysis of extracted hemes

  • Correlation of heme A levels with COX enzyme activity and assembly status

  • Oxygen consumption measurements in intact cells or isolated mitochondria

  • Growth complementation assays in yeast models with COX10 deletions

Considerations for Assay Optimization:

  • Membrane solubilization conditions must preserve enzyme activity

  • Substrate concentrations and reaction conditions need careful optimization

  • Appropriate controls including known COX10 inhibitors or mutants

  • Species-specific differences in optimal reaction conditions

These assays can be used to characterize wild-type and mutant COX10 enzymes, as well as to screen for potential inhibitors in drug discovery applications.

How can researchers effectively use yeast models to study COX10 function and human disease mutations?

Yeast models, including Saccharomyces cerevisiae and Ashbya gossypii, provide powerful systems for studying COX10 function and human disease mutations:

Methodological Approaches:

  • Creation of COX10-null yeast strains through homologous recombination or CRISPR-Cas9

  • Heterologous expression of human COX10 (wild-type or mutant) in yeast deletion strains

  • Site-directed mutagenesis to introduce corresponding mutations in yeast COX10

  • Phenotypic characterization through:

    • Growth on fermentable versus non-fermentable carbon sources

    • Measurement of oxygen consumption

    • Analysis of cytochrome spectra

    • Blue native PAGE to assess complex assembly

Advantages of Yeast Models:

  • Well-characterized genetic tools and resources

  • Ability to survive with defective respiration by fermenting glucose

  • Ease of genetic manipulation

  • Highly conserved mitochondrial functions

  • Rapid growth and cost-effective maintenance

Research Applications:

  • Identification of extragenic suppressors that can bypass COX10 deficiency

  • Analysis of genetic interactions with other assembly factors like Coa1 and Shy1

  • Testing the effect of high-copy expression of interacting genes (e.g., MSS51, COX10)

  • Investigation of novel assembly factors like Coa2 that function in the same pathway

These approaches have provided critical insights into the role of COX10 in cytochrome c oxidase assembly and the molecular basis of associated human diseases.

What is the spectrum of clinical phenotypes associated with COX10 mutations?

COX10 mutations result in a diverse range of clinical presentations, reflecting the critical role of cytochrome c oxidase in cellular energy production:

Clinical Phenotypes:

  • Leigh Syndrome: neurodegenerative disorder characterized by bilateral lesions in the basal ganglia and brainstem

  • Infantile hypertrophic cardiomyopathy: severe heart condition that can be fatal in early childhood

  • Sensorineural deafness: hearing loss due to damage to inner ear structures or nerve pathways

  • Anemia: reduction in red blood cells or hemoglobin, observed in multiple COX10 mutation cases

  • Adult-onset mitochondrial disorders: later-presenting complex multisystem diseases

Genotype-Phenotype Correlations:

Mutation TypeResidual Enzyme ActivityTypical Clinical Presentation
Severe biallelic mutations<10%Fatal infantile disease with cardiomyopathy
Compound heterozygous mutations10-30%Leigh Syndrome with variable age of onset
Milder mutations30-50%Later-onset isolated myopathy or complex symptoms

Research Methodologies:

  • Clinical case series correlating genetic findings with phenotypes

  • Functional studies in patient-derived fibroblasts, measuring:

    • COX enzyme activity

    • Heme A content

    • Assembly of respiratory chain complexes

  • Complementation studies using retroviral expression of wild-type COX10

Understanding this clinical spectrum is essential for accurate diagnosis, genetic counseling, and development of potential therapeutic approaches.

How might COX10-related research inform potential therapeutic strategies for mitochondrial disorders?

Research on COX10 has significant implications for developing therapeutic strategies for mitochondrial disorders:

Potential Therapeutic Approaches:

  • Gene therapy to deliver functional COX10:

    • Retroviral vector delivery has shown efficacy in cellular models

    • AAV-based approaches could target affected tissues in vivo

  • Small molecule interventions:

    • Compounds that bypass heme A requirements

    • Molecules that enhance residual COX10 activity

    • Chaperones to stabilize mutant COX10 proteins

  • Mitochondrial replacement therapy for maternal transmission prevention

  • Enhancement of compensatory pathways:

    • Upregulation of alternative energy production

    • Induction of mitochondrial biogenesis

Research Directions:

  • High-throughput screening for compounds that:

    • Enhance residual COX10 activity

    • Bypass COX10 function through alternative pathways

    • Stabilize partially functional mutant proteins

  • Identification of genetic modifiers that naturally ameliorate disease severity

  • Investigation of synergistic approaches combining multiple therapeutic strategies

Preclinical Validation Methods:

  • Patient-derived cell models

  • Mouse models with corresponding human mutations

  • Yeast models for initial screening and pathway analysis

These research efforts provide a foundation for developing targeted therapies for currently untreatable mitochondrial disorders caused by COX10 mutations and may have broader implications for other cytochrome c oxidase deficiencies.

How is CRISPR-Cas9 technology being applied to study COX10 function?

CRISPR-Cas9 technology has revolutionized genetic manipulation capabilities, offering powerful new approaches to study COX10:

CRISPR Applications in COX10 Research:

  • Generation of precise gene knockouts in various model systems:

    • Cell lines (human, mouse, parasite)

    • Yeast models including Ashbya gossypii

    • Animal models for in vivo studies

  • Introduction of specific point mutations corresponding to patient mutations

  • Creation of conditional knockdown systems:

    • Inducible promoter control

    • Degradation tag systems

  • Multiplex in vivo assembly of DNA for complex genetic manipulations

  • Genome-wide screens to identify synthetic lethal interactions with COX10 deficiency

Methodological Considerations:

  • Selection of appropriate sgRNA design for optimal targeting efficiency

  • Validation of editing efficiency using sequencing techniques

  • Characterization of off-target effects

  • Selection of appropriate promoters (e.g., Ashbya gossypii TEF1 promoter) for expression of CRISPR components

Research Applications:

  • Functional validation of COX10's role in different organisms

  • Modeling human disease mutations in cellular and animal systems

  • Identification of genetic interactions that modify COX10-related phenotypes

  • Development of high-throughput screening platforms for therapeutic discovery

CRISPR-Cas9 technology thus provides unprecedented opportunities to dissect COX10 function with precision and to develop model systems that accurately recapitulate human disease conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.