Recombinant Ashbya gossypii Putative mitochondrial carrier protein PET8 (PET8)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Ashbya gossypii Putative mitochondrial carrier protein PET8 (PET8) is a mitochondrial membrane protein encoded by the PET8 gene (AAL014C) in Ashbya gossypii. This protein belongs to the mitochondrial carrier family (MCF), which facilitates the transport of metabolites across mitochondrial membranes. Recombinant PET8 is produced via heterologous expression systems, primarily in E. coli, and is utilized in research to study mitochondrial transport mechanisms, metabolic regulation, and biotechnological applications .

Primary Structure

PET8 is a full-length protein spanning 271 amino acids (1–271 aa) in Ashbya gossypii. Its amino acid sequence includes conserved motifs characteristic of mitochondrial carriers, such as repeated transmembrane domains. The protein is fused with an N-terminal His-tag for purification via nickel-affinity chromatography .

Amino Acid Sequence (Partial):
MDSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGGYRGIYRGLGSAVVASA PGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQR TQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAA YAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPMLHLARTLFREEGAR VFFRGIGPRTMWISAGGAIFLGVYEAVHSLF .

Recombinant Expression Systems

PET8 is typically expressed in E. coli due to cost-effective scalability and high yield. Alternative hosts, such as yeast or baculovirus systems, are less commonly used for this protein .

ParameterSpecificationSource
HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Stability and Handling

  • Storage: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Glycerol (5–50%) is recommended for long-term stability .

Secretion and Stress Responses

Studies on Ashbya gossypii’s secretome revealed that PET8 is not prominently secreted under standard or stress conditions. Transcriptomic analyses under dithiothreitol-induced secretion stress showed no activation of conventional unfolded protein response (UPR) pathways. Instead, genes involved in endoplasmic reticulum-associated degradation (ERAD) and vacuolar protein sorting were upregulated, suggesting PET8’s role may not directly involve stress response but mitochondrial homeostasis .

Comparative Functional Insights

In S. cerevisiae, PET8 homologs (Sam5p) mediate SAM transport, critical for methylation reactions. Functional reconstitution in lipid vesicles confirmed its carrier activity, while GFP-fusion experiments localized it to mitochondria . These findings imply conserved mitochondrial transport roles across fungi.

Challenges in Heterologous Production

Ashbya gossypii is primarily used for riboflavin production but faces challenges in secreting heterologous proteins. Mutagenesis and genomic engineering (e.g., AgGAS1 deletion) improved secretion efficiency for some proteins, but PET8 production remains niche due to its intracellular localization .

Potential Uses

  • Metabolic Engineering: PET8’s role in SAM transport could inform strategies for optimizing cofactor availability in bioproduction systems .

  • Disease Modeling: Mitochondrial carrier dysfunction is linked to human diseases (e.g., mtDNA depletion syndromes). PET8 homologs may serve as models for studying pathogenic mutations .

Comparative Analysis of PET8 Homologs

SpeciesUniProt IDLength (aa)HostFunction
Ashbya gossypiiO60029271E. coliPutative mitochondrial carrier
Saccharomyces cerevisiaeP31589284E. coliSAM transport
Schizosaccharomyces pombeO94505276E. coliMitochondrial carrier (uncharacterized)

Data compiled from .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening the vial, we recommend a brief centrifugation to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors: storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
PET8; AAL014C; Putative mitochondrial carrier protein PET8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
PET8
Target Protein Sequence
MDSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGGYRGIYRGLGSAVVASA PGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQR TQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAA YAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPMLHLARTLFREEGAR VFFRGIGPRTMWISAGGAIFLGVYEAVHSLF
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression and purification methods for recombinant PET8?

Successful expression and purification of functional recombinant PET8 requires specific methodological considerations:

  • Expression System Selection:

    • E. coli is the preferred heterologous expression system for PET8 .

    • For membrane proteins like PET8, specialized E. coli strains such as C41(DE3) or C43(DE3) may improve expression yields by reducing toxicity.

    • Lower induction temperatures (16-20°C) often improve proper folding of mitochondrial carrier proteins.

  • Construct Design:

    • The full-length sequence (amino acids 1-271) with an N-terminal His-tag has been successfully expressed .

    • Vector selection should include strong promoters (T7) and appropriate selection markers.

    • Codon optimization for E. coli may improve expression levels.

  • Purification Protocol:

    • Cell lysis should be performed in the presence of protease inhibitors to prevent degradation.

    • Initial purification via nickel affinity chromatography using the His-tag.

    • Secondary purification steps may include size exclusion chromatography to achieve >90% purity.

    • Detergent selection is critical for maintaining protein solubility and native conformation.

  • Quality Control:

    • SDS-PAGE analysis to confirm protein purity (>90% is typically achievable) .

    • Western blotting to verify the presence of the His-tag.

    • Circular dichroism spectroscopy to assess proper folding.

These methodological approaches provide a framework for obtaining high-quality recombinant PET8 suitable for subsequent functional and structural studies.

What are the recommended storage conditions for recombinant PET8?

Maintaining stability of purified recombinant PET8 requires careful attention to storage conditions:

  • Short-term Storage:

    • Working aliquots can be maintained at 4°C for up to one week .

    • Protein should be kept in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

    • Avoid repeated freeze-thaw cycles as these significantly reduce protein activity .

  • Long-term Storage:

    • Store at -20°C or preferably -80°C upon receipt .

    • Always prepare multiple small aliquots to avoid repeated freeze-thaw cycles .

    • Addition of glycerol to a final concentration of 5-50% is strongly recommended, with 50% being the standard recommendation for optimal cryoprotection .

  • Reconstitution Protocol:

    • Prior to opening, briefly centrifuge the vial to collect contents at the bottom .

    • Reconstitute lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

    • Allow complete dissolution before any experimental applications.

  • Stability Assessment:

    • Periodic quality control should be performed on stored samples.

    • Activity assays or spectroscopic methods can verify retention of native structure.

    • Any cloudiness or precipitation indicates potential denaturation.

Adherence to these storage guidelines is essential for maintaining the structural integrity and functional activity of recombinant PET8 across multiple experimental applications.

How is PET8 localization determined in cellular systems?

Determining the precise subcellular localization of PET8 requires multiple complementary approaches:

  • Fluorescent Protein Fusion:

    • Generation of PET8-GFP fusion constructs allows visualization in living cells .

    • Expression of these constructs followed by confocal microscopy reveals the mitochondrial localization pattern.

    • Co-localization with established mitochondrial markers (MitoTracker dyes, mitochondrial-targeted fluorescent proteins) confirms specificity.

  • Immunolocalization:

    • Development of specific antibodies against PET8 or detection of epitope-tagged versions.

    • Immunofluorescence microscopy with appropriate fixation protocols preserving mitochondrial structure.

    • Dual labeling with established mitochondrial markers ensures accurate assignment.

  • Biochemical Fractionation:

    • Differential centrifugation to isolate mitochondrial fractions.

    • Western blot analysis of subcellular fractions using anti-PET8 antibodies.

    • Inclusion of marker proteins for different compartments (cytosol, mitochondria, ER) confirms fractionation quality.

  • Protease Protection Assays:

    • Isolated mitochondria treated with proteases in the presence or absence of membrane-disrupting detergents.

    • Analysis of PET8 degradation patterns reveals topology within the mitochondrial membranes.

    • These assays can distinguish outer membrane, intermembrane space, inner membrane, and matrix localization.

Research has confirmed that PET8-GFP protein is indeed targeted to mitochondria, consistent with its function as a mitochondrial carrier protein . This proper localization is essential for its biological role in transporting SAM across the mitochondrial membrane.

What are the functional consequences of PET8 deletion or mutation?

Genetic manipulation of PET8 reveals critical insights into its functional significance:

  • Growth Phenotypes:

    • Cells lacking PET8 show auxotrophy for biotin when grown on fermentable carbon sources .

    • A characteristic petite phenotype is observed when PET8-deficient cells are cultured on non-fermentable substrates .

    • These phenotypes directly link PET8 function to essential mitochondrial metabolic pathways.

  • Metabolic Consequences:

    • The biotin auxotrophy stems from the requirement for SAM by Bio2p, a mitochondrial enzyme involved in biotin synthesis .

    • Without PET8-mediated SAM transport, this biosynthetic pathway is disrupted.

    • Comprehensive metabolomic analysis of PET8 mutants would likely reveal additional metabolic perturbations beyond biotin metabolism.

  • Rescue Experiments:

    • Both phenotypes of PET8 deletion can be overcome by expressing the cytosolic SAM synthetase (Sam1p) inside mitochondria .

    • This functional complementation confirms that the primary role of PET8 is indeed SAM transport.

    • The ability to rescue with mitochondrially-targeted SAM synthetase provides a valuable experimental tool for analyzing PET8 variants.

  • Mutation Analysis:

    • Point mutations in conserved residues can identify amino acids critical for transport function.

    • Domain swap experiments with other mitochondrial carriers can define regions responsible for substrate specificity.

    • Analysis of naturally occurring variants may reveal functional adaptations across fungal species.

These findings demonstrate that PET8 plays an essential role in mitochondrial metabolism, particularly in pathways requiring SAM as a cofactor or substrate.

How can PET8 transport activity be measured experimentally?

Quantitative assessment of PET8 transport activity requires sophisticated biochemical approaches:

  • Liposome Reconstitution System:

    • Purified recombinant PET8 is reconstituted into phospholipid vesicles (liposomes) .

    • This system provides a controlled environment for measuring transport kinetics.

    • Key parameters for optimization include:

      • Protein-to-lipid ratio

      • Lipid composition

      • Buffer conditions (pH, salt concentration)

      • Temperature

  • Substrate Transport Assays:

    • Radioactively labeled SAM (typically [³H]- or [¹⁴C]-SAM) is used to measure transport rates.

    • Transport is initiated by adding labeled substrate to the external medium.

    • At defined time points, transport is terminated by rapid filtration or centrifugation.

    • Uptake is quantified by scintillation counting of entrapped radioactivity.

  • Kinetic Analysis:

    • Determination of transport kinetics parameters:

      ParameterTypical Measurement MethodExpected Range
      KmVarying substrate concentrationμM range for mitochondrial carriers
      VmaxSaturating substrate conditionsnmol/min/mg protein
      Substrate specificityCompetition assaysRelative affinity (%)
      Inhibition constantsInhibitor titrationIC₅₀ or Ki values
  • Electrophysiological Measurements:

    • Advanced techniques include incorporation of purified PET8 into planar lipid bilayers.

    • Patch-clamp recordings can detect electrogenic transport activity.

    • This approach provides insights into transport mechanism and energetics.

These methodological approaches allow for detailed characterization of PET8 transport properties and provide a foundation for comparative studies with mutant variants or homologs from different species.

What is the relationship between PET8 function and mitochondrial metabolism in Ashbya gossypii?

PET8's role as a SAM transporter integrates with broader mitochondrial metabolic networks:

  • Impact on Biotin Metabolism:

    • SAM transported by PET8 is required for the activity of Bio2p in the mitochondrial biotin synthesis pathway .

    • This connection explains the biotin auxotrophy observed in PET8-deficient cells .

    • As biotin serves as an essential cofactor for carboxylases, PET8 function indirectly impacts fatty acid metabolism and gluconeogenesis.

  • Methylation-Dependent Processes:

    • As the principal methyl donor, SAM is required for numerous methylation reactions within mitochondria.

    • These include:

      • Methylation of mitochondrial DNA and RNA

      • Post-translational modifications of mitochondrial proteins

      • Synthesis of small molecules requiring methylation steps

  • Potential Connections to Riboflavin Metabolism:

    • A. gossypii is known for its capacity to produce riboflavin (vitamin B₂) and has been metabolically engineered for enhanced FAD production .

    • While direct evidence is limited, SAM-dependent methylation steps may influence regulation of riboflavin biosynthetic pathways.

    • The interconnection of mitochondrial redox metabolism with riboflavin production suggests potential regulatory links.

  • Energy Metabolism:

    • The petite phenotype observed on non-fermentable substrates indicates a critical role in respiratory metabolism .

    • This suggests that PET8-mediated SAM transport may impact the assembly or function of respiratory chain complexes.

    • Mitochondrial function in A. gossypii, particularly during filamentous growth, may have unique dependencies on PET8 activity.

Understanding these metabolic interconnections provides opportunities for targeted metabolic engineering strategies in A. gossypii, particularly for applications involving vitamin production or other biotechnological processes.

How does the structure of PET8 relate to its function as a mitochondrial carrier?

The structure-function relationship of PET8 follows principles established for mitochondrial carrier proteins:

  • Structural Organization:

    • PET8, like other mitochondrial carriers, likely contains six transmembrane segments organized in three repeats.

    • Each repeat contains two transmembrane α-helices connected by hydrophilic loops.

    • This creates a three-fold pseudo-symmetrical structure forming a translocation pathway.

  • Functional Domains:

    • The C-terminal region of PET8 appears sufficient for correct localization to mitochondria .

    • This localization domain functions not only in the native context but also when expressed in Saccharomyces cerevisiae .

    • The substrate binding site likely involves residues from multiple transmembrane segments forming a central cavity.

  • Transport Mechanism:

    • PET8 likely operates through an alternating access mechanism typical of carrier proteins.

    • Key features include:

      • Substrate binding on one side of the membrane

      • Conformational change exposing binding site to opposite side

      • Release of substrate

      • Return to original conformation

  • Critical Residues:

    • Sequence analysis of the 271-amino acid PET8 protein reveals conserved motifs characteristic of mitochondrial carriers .

    • These include:

      • PX[D/E]XX[K/R] motifs in transmembrane domains

      • Conserved proline residues facilitating conformational changes

      • Charged residues forming the substrate binding site

Structural studies of reconstituted PET8 could provide valuable insights into the molecular details of SAM recognition and transport, potentially informing the design of inhibitors or engineering of carriers with modified substrate specificity.

What approaches can be used to study PET8 interactions with the mitochondrial proteome?

Investigating PET8's interaction network requires specialized techniques for membrane protein complexes:

  • Affinity Purification-Mass Spectrometry:

    • Expression of tagged PET8 (such as His-tagged recombinant protein) allows for selective purification.

    • Mild solubilization conditions preserve protein-protein interactions.

    • Cross-linking approaches can capture transient interactions.

    • Mass spectrometry identification of co-purifying proteins reveals interaction partners.

    Sample PreparationAdvantagesLimitations
    Native conditionsPreserves physiological interactionsMay miss weak interactions
    Chemical cross-linkingCaptures transient interactionsMay introduce artifacts
    Stable isotope labelingAllows quantitative comparisonRequires specialized MS analysis
  • Proximity-Based Labeling:

    • Fusion of PET8 with enzymes like BioID or APEX2.

    • These enzymes modify proteins in close proximity to PET8 in living cells.

    • Modified proteins are isolated and identified by mass spectrometry.

    • This approach is particularly valuable for membrane proteins and captures spatial relationships in the native environment.

  • Genetic Interaction Mapping:

    • Systematic combination of PET8 deletion/mutation with other gene mutations.

    • Synthetic genetic array (SGA) analysis reveals functional relationships.

    • Genetic interactions often reflect physical interactions or pathway connections.

    • This approach can identify functionally related proteins even when physical interactions are transient.

  • Split-Reporter Systems:

    • Fusion of PET8 with one half of a reporter protein (e.g., split GFP, split luciferase).

    • Complementary proteins fused with candidate interactors.

    • Reporter signal is generated only when proteins interact, bringing the reporter halves together.

    • This approach can be used for targeted validation of specific interactions.

These complementary approaches provide a comprehensive view of PET8's functional integration within the mitochondrial proteome and metabolic networks.

How can genome editing techniques be applied to study PET8 function in Ashbya gossypii?

Modern genome editing approaches offer powerful tools for PET8 functional analysis:

  • CRISPR-Cas9 System Implementation:

    • Adaptation of CRISPR-Cas9 tools for A. gossypii enables precise genomic modifications.

    • Design considerations include:

      • Selection of appropriate promoters for Cas9 and guide RNA expression

      • Optimization of guide RNA sequences for PET8 targeting

      • Development of efficient transformation protocols for filamentous fungi

      • Selection of appropriate markers for transformant identification

  • Targeted Modifications:

    • Precise alterations to the endogenous PET8 locus:

      • Complete gene deletion to study loss-of-function phenotypes

      • Point mutations to analyze structure-function relationships

      • Addition of epitope tags for protein detection and localization

      • Introduction of fluorescent protein fusions for live-cell imaging

  • Promoter Engineering:

    • Following successful strategies used for other A. gossypii genes, the native PET8 promoter can be replaced with regulatable alternatives .

    • The GPD (Glyceraldehyde-3-phosphate dehydrogenase) promoter has proven effective for constitutive expression in A. gossypii .

  • Comparative Analysis:

    • Generation of isogenic strains with varying PET8 expression levels.

    • Phenotypic characterization under different growth conditions.

    • Metabolic profiling to identify pathways affected by PET8 modulation.

    • Integration with systems biology approaches to understand network-level effects.

These genome editing strategies provide a foundation for comprehensive analysis of PET8 function in its native context within A. gossypii.

What is the potential relationship between PET8 function and riboflavin production in Ashbya gossypii?

A. gossypii is known for its industrial importance in riboflavin production, suggesting potential connections with PET8 function:

  • Metabolic Intersections:

    • While direct evidence remains limited, several pathways connect PET8-mediated SAM transport with riboflavin metabolism:

      • SAM-dependent methylation reactions in regulatory pathways

      • Mitochondrial energy production supporting biosynthetic processes

      • Potential regulatory crosstalk between different vitamin biosynthesis pathways

  • Comparison with FAD Production Enhancement:

    • Recent work has demonstrated that overexpression of the FMN1 gene in A. gossypii leads to enhanced FAD production .

    • This was achieved through a promoter replacement strategy similar to what could be applied to PET8 .

    • The recombinant strain showed a 35.67-fold increase in riboflavin kinase activity and a 14.02-fold increase in FAD production .

    • This suggests that similar metabolic engineering approaches could be applied to PET8 to explore its impact on riboflavin metabolism.

  • Experimental Approaches:

    • Generate PET8 overexpression strains using strong constitutive promoters.

    • Analyze riboflavin production under various cultivation conditions.

    • Perform comparative transcriptomics and metabolomics between wild-type and PET8-modified strains.

    • Create double-modification strains combining PET8 alterations with known riboflavin pathway modifications.

  • Industrial Applications:

    • Understanding the relationship between mitochondrial SAM transport and riboflavin production could lead to new strategies for strain improvement.

    • Coordinated engineering of multiple transporters might enhance metabolic flux toward desired products.

    • Integration with existing bioprocess optimization approaches could further improve industrial production strains.

These investigations could reveal unexpected connections between mitochondrial transport functions and industrial vitamin production, potentially leading to new biotechnological applications.

How can systems biology approaches integrate PET8 function into broader metabolic networks?

Comprehensive understanding of PET8's role requires integration of multiple data types:

  • Multi-omics Integration:

    • Collection and integration of multiple data types:

      • Transcriptomics: Identify gene expression changes in response to PET8 modification

      • Proteomics: Quantify protein-level alterations in mitochondrial carriers and metabolic enzymes

      • Metabolomics: Detect changes in metabolite profiles, particularly SAM-related pathways

      • Fluxomics: Measure alterations in metabolic flux distributions

  • Network Analysis:

    • Construction of functional networks connecting PET8 with other cellular components:

      • Protein-protein interaction networks identifying physical associations

      • Genetic interaction networks revealing functional relationships

      • Metabolic networks mapping biochemical connections

      • Regulatory networks identifying transcriptional and post-transcriptional control mechanisms

  • Computational Modeling:

    • Development of mathematical models incorporating PET8 transport kinetics:

      • Kinetic models of SAM transport and metabolism

      • Constraint-based models of A. gossypii metabolism

      • Dynamic models of mitochondrial carrier function

      • Genome-scale metabolic models predicting system-wide effects of PET8 modifications

  • Comparative Analysis Across Species:

    • Examination of PET8 homologs in different organisms:

      • Functional conservation between A. gossypii PET8 and S. cerevisiae Sam5p

      • Evolutionary adaptations in mitochondrial transport systems

      • Species-specific integration with metabolic networks

      • Identification of conserved vs. divergent regulatory mechanisms

These systems biology approaches provide a holistic understanding of PET8's role within the complex network of mitochondrial functions and cellular metabolism, extending beyond its immediate transport function to broader physiological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.