Recombinant Ashbya gossypii Putative mitochondrial carrier protein PET8 (PET8) is a mitochondrial membrane protein encoded by the PET8 gene (AAL014C) in Ashbya gossypii. This protein belongs to the mitochondrial carrier family (MCF), which facilitates the transport of metabolites across mitochondrial membranes. Recombinant PET8 is produced via heterologous expression systems, primarily in E. coli, and is utilized in research to study mitochondrial transport mechanisms, metabolic regulation, and biotechnological applications .
PET8 is a full-length protein spanning 271 amino acids (1–271 aa) in Ashbya gossypii. Its amino acid sequence includes conserved motifs characteristic of mitochondrial carriers, such as repeated transmembrane domains. The protein is fused with an N-terminal His-tag for purification via nickel-affinity chromatography .
Amino Acid Sequence (Partial):
MDSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGGYRGIYRGLGSAVVASA PGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQR TQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAA YAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPMLHLARTLFREEGAR VFFRGIGPRTMWISAGGAIFLGVYEAVHSLF .
PET8 is typically expressed in E. coli due to cost-effective scalability and high yield. Alternative hosts, such as yeast or baculovirus systems, are less commonly used for this protein .
| Parameter | Specification | Source |
|---|---|---|
| Host | E. coli | |
| Tag | N-terminal His-tag | |
| Purity | >90% (SDS-PAGE) | |
| Storage Buffer | Tris/PBS-based, 6% trehalose, pH 8.0 | |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL) |
Storage: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .
Reconstitution: Glycerol (5–50%) is recommended for long-term stability .
Studies on Ashbya gossypii’s secretome revealed that PET8 is not prominently secreted under standard or stress conditions. Transcriptomic analyses under dithiothreitol-induced secretion stress showed no activation of conventional unfolded protein response (UPR) pathways. Instead, genes involved in endoplasmic reticulum-associated degradation (ERAD) and vacuolar protein sorting were upregulated, suggesting PET8’s role may not directly involve stress response but mitochondrial homeostasis .
In S. cerevisiae, PET8 homologs (Sam5p) mediate SAM transport, critical for methylation reactions. Functional reconstitution in lipid vesicles confirmed its carrier activity, while GFP-fusion experiments localized it to mitochondria . These findings imply conserved mitochondrial transport roles across fungi.
Ashbya gossypii is primarily used for riboflavin production but faces challenges in secreting heterologous proteins. Mutagenesis and genomic engineering (e.g., AgGAS1 deletion) improved secretion efficiency for some proteins, but PET8 production remains niche due to its intracellular localization .
Metabolic Engineering: PET8’s role in SAM transport could inform strategies for optimizing cofactor availability in bioproduction systems .
Disease Modeling: Mitochondrial carrier dysfunction is linked to human diseases (e.g., mtDNA depletion syndromes). PET8 homologs may serve as models for studying pathogenic mutations .
| Species | UniProt ID | Length (aa) | Host | Function |
|---|---|---|---|---|
| Ashbya gossypii | O60029 | 271 | E. coli | Putative mitochondrial carrier |
| Saccharomyces cerevisiae | P31589 | 284 | E. coli | SAM transport |
| Schizosaccharomyces pombe | O94505 | 276 | E. coli | Mitochondrial carrier (uncharacterized) |
KEGG: ago:AGOS_AAL014C
Successful expression and purification of functional recombinant PET8 requires specific methodological considerations:
Expression System Selection:
E. coli is the preferred heterologous expression system for PET8 .
For membrane proteins like PET8, specialized E. coli strains such as C41(DE3) or C43(DE3) may improve expression yields by reducing toxicity.
Lower induction temperatures (16-20°C) often improve proper folding of mitochondrial carrier proteins.
Construct Design:
Purification Protocol:
Cell lysis should be performed in the presence of protease inhibitors to prevent degradation.
Initial purification via nickel affinity chromatography using the His-tag.
Secondary purification steps may include size exclusion chromatography to achieve >90% purity.
Detergent selection is critical for maintaining protein solubility and native conformation.
Quality Control:
These methodological approaches provide a framework for obtaining high-quality recombinant PET8 suitable for subsequent functional and structural studies.
Maintaining stability of purified recombinant PET8 requires careful attention to storage conditions:
Short-term Storage:
Long-term Storage:
Reconstitution Protocol:
Stability Assessment:
Periodic quality control should be performed on stored samples.
Activity assays or spectroscopic methods can verify retention of native structure.
Any cloudiness or precipitation indicates potential denaturation.
Adherence to these storage guidelines is essential for maintaining the structural integrity and functional activity of recombinant PET8 across multiple experimental applications.
Determining the precise subcellular localization of PET8 requires multiple complementary approaches:
Fluorescent Protein Fusion:
Generation of PET8-GFP fusion constructs allows visualization in living cells .
Expression of these constructs followed by confocal microscopy reveals the mitochondrial localization pattern.
Co-localization with established mitochondrial markers (MitoTracker dyes, mitochondrial-targeted fluorescent proteins) confirms specificity.
Immunolocalization:
Development of specific antibodies against PET8 or detection of epitope-tagged versions.
Immunofluorescence microscopy with appropriate fixation protocols preserving mitochondrial structure.
Dual labeling with established mitochondrial markers ensures accurate assignment.
Biochemical Fractionation:
Differential centrifugation to isolate mitochondrial fractions.
Western blot analysis of subcellular fractions using anti-PET8 antibodies.
Inclusion of marker proteins for different compartments (cytosol, mitochondria, ER) confirms fractionation quality.
Protease Protection Assays:
Isolated mitochondria treated with proteases in the presence or absence of membrane-disrupting detergents.
Analysis of PET8 degradation patterns reveals topology within the mitochondrial membranes.
These assays can distinguish outer membrane, intermembrane space, inner membrane, and matrix localization.
Research has confirmed that PET8-GFP protein is indeed targeted to mitochondria, consistent with its function as a mitochondrial carrier protein . This proper localization is essential for its biological role in transporting SAM across the mitochondrial membrane.
Genetic manipulation of PET8 reveals critical insights into its functional significance:
Growth Phenotypes:
Metabolic Consequences:
The biotin auxotrophy stems from the requirement for SAM by Bio2p, a mitochondrial enzyme involved in biotin synthesis .
Without PET8-mediated SAM transport, this biosynthetic pathway is disrupted.
Comprehensive metabolomic analysis of PET8 mutants would likely reveal additional metabolic perturbations beyond biotin metabolism.
Rescue Experiments:
Both phenotypes of PET8 deletion can be overcome by expressing the cytosolic SAM synthetase (Sam1p) inside mitochondria .
This functional complementation confirms that the primary role of PET8 is indeed SAM transport.
The ability to rescue with mitochondrially-targeted SAM synthetase provides a valuable experimental tool for analyzing PET8 variants.
Mutation Analysis:
Point mutations in conserved residues can identify amino acids critical for transport function.
Domain swap experiments with other mitochondrial carriers can define regions responsible for substrate specificity.
Analysis of naturally occurring variants may reveal functional adaptations across fungal species.
These findings demonstrate that PET8 plays an essential role in mitochondrial metabolism, particularly in pathways requiring SAM as a cofactor or substrate.
Quantitative assessment of PET8 transport activity requires sophisticated biochemical approaches:
Liposome Reconstitution System:
Purified recombinant PET8 is reconstituted into phospholipid vesicles (liposomes) .
This system provides a controlled environment for measuring transport kinetics.
Key parameters for optimization include:
Protein-to-lipid ratio
Lipid composition
Buffer conditions (pH, salt concentration)
Temperature
Substrate Transport Assays:
Radioactively labeled SAM (typically [³H]- or [¹⁴C]-SAM) is used to measure transport rates.
Transport is initiated by adding labeled substrate to the external medium.
At defined time points, transport is terminated by rapid filtration or centrifugation.
Uptake is quantified by scintillation counting of entrapped radioactivity.
Kinetic Analysis:
Determination of transport kinetics parameters:
| Parameter | Typical Measurement Method | Expected Range |
|---|---|---|
| Km | Varying substrate concentration | μM range for mitochondrial carriers |
| Vmax | Saturating substrate conditions | nmol/min/mg protein |
| Substrate specificity | Competition assays | Relative affinity (%) |
| Inhibition constants | Inhibitor titration | IC₅₀ or Ki values |
Electrophysiological Measurements:
Advanced techniques include incorporation of purified PET8 into planar lipid bilayers.
Patch-clamp recordings can detect electrogenic transport activity.
This approach provides insights into transport mechanism and energetics.
These methodological approaches allow for detailed characterization of PET8 transport properties and provide a foundation for comparative studies with mutant variants or homologs from different species.
PET8's role as a SAM transporter integrates with broader mitochondrial metabolic networks:
Impact on Biotin Metabolism:
SAM transported by PET8 is required for the activity of Bio2p in the mitochondrial biotin synthesis pathway .
This connection explains the biotin auxotrophy observed in PET8-deficient cells .
As biotin serves as an essential cofactor for carboxylases, PET8 function indirectly impacts fatty acid metabolism and gluconeogenesis.
Methylation-Dependent Processes:
As the principal methyl donor, SAM is required for numerous methylation reactions within mitochondria.
These include:
Methylation of mitochondrial DNA and RNA
Post-translational modifications of mitochondrial proteins
Synthesis of small molecules requiring methylation steps
Potential Connections to Riboflavin Metabolism:
A. gossypii is known for its capacity to produce riboflavin (vitamin B₂) and has been metabolically engineered for enhanced FAD production .
While direct evidence is limited, SAM-dependent methylation steps may influence regulation of riboflavin biosynthetic pathways.
The interconnection of mitochondrial redox metabolism with riboflavin production suggests potential regulatory links.
Energy Metabolism:
The petite phenotype observed on non-fermentable substrates indicates a critical role in respiratory metabolism .
This suggests that PET8-mediated SAM transport may impact the assembly or function of respiratory chain complexes.
Mitochondrial function in A. gossypii, particularly during filamentous growth, may have unique dependencies on PET8 activity.
Understanding these metabolic interconnections provides opportunities for targeted metabolic engineering strategies in A. gossypii, particularly for applications involving vitamin production or other biotechnological processes.
The structure-function relationship of PET8 follows principles established for mitochondrial carrier proteins:
Structural Organization:
PET8, like other mitochondrial carriers, likely contains six transmembrane segments organized in three repeats.
Each repeat contains two transmembrane α-helices connected by hydrophilic loops.
This creates a three-fold pseudo-symmetrical structure forming a translocation pathway.
Functional Domains:
The C-terminal region of PET8 appears sufficient for correct localization to mitochondria .
This localization domain functions not only in the native context but also when expressed in Saccharomyces cerevisiae .
The substrate binding site likely involves residues from multiple transmembrane segments forming a central cavity.
Transport Mechanism:
PET8 likely operates through an alternating access mechanism typical of carrier proteins.
Key features include:
Substrate binding on one side of the membrane
Conformational change exposing binding site to opposite side
Release of substrate
Return to original conformation
Critical Residues:
Structural studies of reconstituted PET8 could provide valuable insights into the molecular details of SAM recognition and transport, potentially informing the design of inhibitors or engineering of carriers with modified substrate specificity.
Investigating PET8's interaction network requires specialized techniques for membrane protein complexes:
Affinity Purification-Mass Spectrometry:
Expression of tagged PET8 (such as His-tagged recombinant protein) allows for selective purification.
Mild solubilization conditions preserve protein-protein interactions.
Cross-linking approaches can capture transient interactions.
Mass spectrometry identification of co-purifying proteins reveals interaction partners.
| Sample Preparation | Advantages | Limitations |
|---|---|---|
| Native conditions | Preserves physiological interactions | May miss weak interactions |
| Chemical cross-linking | Captures transient interactions | May introduce artifacts |
| Stable isotope labeling | Allows quantitative comparison | Requires specialized MS analysis |
Proximity-Based Labeling:
Fusion of PET8 with enzymes like BioID or APEX2.
These enzymes modify proteins in close proximity to PET8 in living cells.
Modified proteins are isolated and identified by mass spectrometry.
This approach is particularly valuable for membrane proteins and captures spatial relationships in the native environment.
Genetic Interaction Mapping:
Systematic combination of PET8 deletion/mutation with other gene mutations.
Synthetic genetic array (SGA) analysis reveals functional relationships.
Genetic interactions often reflect physical interactions or pathway connections.
This approach can identify functionally related proteins even when physical interactions are transient.
Split-Reporter Systems:
Fusion of PET8 with one half of a reporter protein (e.g., split GFP, split luciferase).
Complementary proteins fused with candidate interactors.
Reporter signal is generated only when proteins interact, bringing the reporter halves together.
This approach can be used for targeted validation of specific interactions.
These complementary approaches provide a comprehensive view of PET8's functional integration within the mitochondrial proteome and metabolic networks.
Modern genome editing approaches offer powerful tools for PET8 functional analysis:
CRISPR-Cas9 System Implementation:
Adaptation of CRISPR-Cas9 tools for A. gossypii enables precise genomic modifications.
Design considerations include:
Selection of appropriate promoters for Cas9 and guide RNA expression
Optimization of guide RNA sequences for PET8 targeting
Development of efficient transformation protocols for filamentous fungi
Selection of appropriate markers for transformant identification
Targeted Modifications:
Precise alterations to the endogenous PET8 locus:
Complete gene deletion to study loss-of-function phenotypes
Point mutations to analyze structure-function relationships
Addition of epitope tags for protein detection and localization
Introduction of fluorescent protein fusions for live-cell imaging
Promoter Engineering:
Comparative Analysis:
Generation of isogenic strains with varying PET8 expression levels.
Phenotypic characterization under different growth conditions.
Metabolic profiling to identify pathways affected by PET8 modulation.
Integration with systems biology approaches to understand network-level effects.
These genome editing strategies provide a foundation for comprehensive analysis of PET8 function in its native context within A. gossypii.
A. gossypii is known for its industrial importance in riboflavin production, suggesting potential connections with PET8 function:
Metabolic Intersections:
While direct evidence remains limited, several pathways connect PET8-mediated SAM transport with riboflavin metabolism:
SAM-dependent methylation reactions in regulatory pathways
Mitochondrial energy production supporting biosynthetic processes
Potential regulatory crosstalk between different vitamin biosynthesis pathways
Comparison with FAD Production Enhancement:
Recent work has demonstrated that overexpression of the FMN1 gene in A. gossypii leads to enhanced FAD production .
This was achieved through a promoter replacement strategy similar to what could be applied to PET8 .
The recombinant strain showed a 35.67-fold increase in riboflavin kinase activity and a 14.02-fold increase in FAD production .
This suggests that similar metabolic engineering approaches could be applied to PET8 to explore its impact on riboflavin metabolism.
Experimental Approaches:
Generate PET8 overexpression strains using strong constitutive promoters.
Analyze riboflavin production under various cultivation conditions.
Perform comparative transcriptomics and metabolomics between wild-type and PET8-modified strains.
Create double-modification strains combining PET8 alterations with known riboflavin pathway modifications.
Industrial Applications:
Understanding the relationship between mitochondrial SAM transport and riboflavin production could lead to new strategies for strain improvement.
Coordinated engineering of multiple transporters might enhance metabolic flux toward desired products.
Integration with existing bioprocess optimization approaches could further improve industrial production strains.
These investigations could reveal unexpected connections between mitochondrial transport functions and industrial vitamin production, potentially leading to new biotechnological applications.
Comprehensive understanding of PET8's role requires integration of multiple data types:
Multi-omics Integration:
Collection and integration of multiple data types:
Transcriptomics: Identify gene expression changes in response to PET8 modification
Proteomics: Quantify protein-level alterations in mitochondrial carriers and metabolic enzymes
Metabolomics: Detect changes in metabolite profiles, particularly SAM-related pathways
Fluxomics: Measure alterations in metabolic flux distributions
Network Analysis:
Construction of functional networks connecting PET8 with other cellular components:
Protein-protein interaction networks identifying physical associations
Genetic interaction networks revealing functional relationships
Metabolic networks mapping biochemical connections
Regulatory networks identifying transcriptional and post-transcriptional control mechanisms
Computational Modeling:
Development of mathematical models incorporating PET8 transport kinetics:
Kinetic models of SAM transport and metabolism
Constraint-based models of A. gossypii metabolism
Dynamic models of mitochondrial carrier function
Genome-scale metabolic models predicting system-wide effects of PET8 modifications
Comparative Analysis Across Species:
Examination of PET8 homologs in different organisms:
These systems biology approaches provide a holistic understanding of PET8's role within the complex network of mitochondrial functions and cellular metabolism, extending beyond its immediate transport function to broader physiological significance.