Recombinant Ashbya gossypii Rhomboid protein 2 (RBD2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant RBD2 is synthesized via heterologous expression in E. coli. Critical steps include:

  • Cloning: Full-length RBD2 gene (1–261 aa) inserted into an expression vector .

  • Induction: Optimized for soluble protein yield under specific growth conditions.

  • Purification: Affinity chromatography using His-tag, followed by buffer exchange and lyophilization .

This method ensures high reproducibility, with typical yields of 0.1–1.0 mg/mL post-reconstitution .

Functional Insights

While RBD2’s exact biological role in A. gossypii remains understudied, genomic and proteomic analyses provide clues:

  • Secretome Association: RBD2 is part of A. gossypii’s predicted secretome, though its secretion efficiency in native hosts is low compared to hydrolases .

  • Stress Response: Unlike typical unfolded protein response (UPR) pathways, RBD2 expression remains unaffected during dithiothreitol-induced secretion stress, suggesting alternative regulatory mechanisms .

  • Industrial Context: A. gossypii’s secretory machinery has been engineered for recombinant protein production, but RBD2-specific applications are yet to be explored .

Comparative Analysis with Homologs

RBD2 shares functional domains with rhomboid proteases across fungi. Key comparisons:

OrganismProteinFunctionExpression System
Candida albicansRBD2Putative protease activityE. coli
Saccharomyces cerevisiaeRHBDMitochondrial membrane remodelingYeast
Ashbya gossypiiRBD2Undetermined; structural studiesE. coli

Research Applications

  • Enzymatic Studies: Used to investigate rhomboid protease kinetics and substrate specificity.

  • Structural Biology: Crystallization trials for 3D modeling .

  • Biotech Engineering: Serves as a model for optimizing fungal secretory pathways .

Challenges and Future Directions

  • Low Secretion Efficiency: Native A. gossypii strains poorly secrete RBD2, necessitating strain engineering (e.g., promoter optimization or GAS1 gene deletion) .

  • Functional Annotation: Further studies required to elucidate its role in fungal physiology and industrial processes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution, storing it at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. To ensure optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type determination occurs during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
RBD2; AFL155C; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
RBD2
Target Protein Sequence
MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLDPGALRKLQLTRLSLYP LAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIVTGVVYCLVGMLLYPNVYV GGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLVFLVLVTLLMPGSSFVGHLIG LGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMIPSVVKYHRESSVDRTAGYTPLY QESELPLHNDNFPGQGRVLGP
Uniprot No.

Target Background

Function
This protein is likely a serine protease.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii Rhomboid protein 2 (RBD2) and what is its function?

RBD2 (gene name: RBD2, ordered locus name: AFL155C) is a rhomboid protein expressed in the filamentous fungus Ashbya gossypii (also known as Eremothecium gossypii). It belongs to the rhomboid family of intramembrane serine proteases (EC 3.4.21.-) that typically cleave transmembrane proteins within their transmembrane domains . The protein consists of 261 amino acids and likely functions in protein quality control, membrane protein processing, and potentially in stress response pathways within the fungus . RBD2 may play a role in the secretory pathway of A. gossypii, which has been studied for its protein production capabilities, particularly as this fungus has evolved specialized pathways for natural overproduction of riboflavin .

How does RBD2 relate to the secretory pathway in A. gossypii?

The secretory pathway in A. gossypii is of particular interest to researchers as this organism has been explored as a host system for recombinant protein production. Genome-wide analyses have revealed that approximately 1-4% of A. gossypii proteins are likely secreted, with less than 33% being putative hydrolases . As a membrane protein, RBD2 may participate in protein quality control within the secretory pathway, potentially influencing the processing of other proteins destined for secretion .

Unlike conventional responses observed in other fungi, A. gossypii cells under secretion stress do not activate a typical unfolded protein response (UPR), as UPR target genes (IRE1, KAR2, HAC1, and PDI1 homologs) remain unaffected . Instead, genes involved in protein unfolding, endoplasmic reticulum-associated degradation, proteolysis, and vesicle trafficking are upregulated. Understanding RBD2's role in this unconventional stress response could provide insights into the unique secretory characteristics of this fungus .

What are the optimal conditions for recombinant expression of A. gossypii RBD2?

For recombinant expression of A. gossypii RBD2, researchers should consider using either heterologous expression systems (such as E. coli, as demonstrated with other recombinant proteins) or homologous expression within A. gossypii itself . For heterologous expression, several key parameters should be optimized:

Expression System Selection:

  • E. coli: Suitable for initial studies, though membrane proteins often present challenges

  • Yeast systems (S. cerevisiae or P. pastoris): May provide better folding for fungal proteins

  • Homologous expression in A. gossypii: Potentially optimal for proper folding and modification

Expression Conditions Table:

ParameterRecommended RangeConsiderations
Temperature18-30°CLower temperatures (18-25°C) often improve folding of membrane proteins
InductionSystem-dependentFor E. coli: 0.1-1.0 mM IPTG; for yeast: 0.5-2% methanol or galactose
Duration4-48 hoursMembrane proteins often benefit from longer, gentler expression
MediaRich or minimalSupplementation with glycerol (0.5-2%) may improve membrane protein yields
Additives5-10% glycerolMay stabilize membrane proteins during expression

When using A. gossypii as the expression host, researchers should note that the fungus grows in a filamentous manner, beginning with a spore form (isotropic growth) followed by apical growth with germ tube extension . Special attention should be paid to the growth phase during protein expression, as the secretory capacity may vary during different developmental stages .

What purification strategies yield the highest purity and activity of recombinant RBD2?

Purification of membrane proteins like RBD2 requires specialized approaches to maintain structure and activity. Based on established protocols for similar proteins, a multi-step strategy is recommended:

  • Membrane Isolation: Cell disruption (typically by sonication or homogenization) followed by differential centrifugation to isolate membrane fractions .

  • Solubilization: Use of detergents to extract RBD2 from membranes. Consider a panel of detergents:

    • Mild detergents: n-Dodecyl β-D-maltoside (DDM), digitonin

    • Medium-strength: CHAPS, Triton X-100

    • Stronger detergents: Sodium dodecyl sulfate (SDS)

  • Affinity Chromatography: If expressed with an affinity tag, Ni-NTA chromatography for His-tagged proteins has proven effective with other recombinant proteins . The tag type will be determined during the production process for optimal results .

  • Size Exclusion Chromatography: For further purification and to assess oligomeric state.

  • Storage: Maintain in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

For activity preservation, consider including protease inhibitors throughout the purification process and maintaining the protein in detergent micelles above the critical micelle concentration.

How can researchers accurately determine RBD2 activity in vitro?

Assessing the proteolytic activity of rhomboid proteins like RBD2 requires specialized approaches:

Fluorogenic Substrate Assay:

  • Design fluorogenic peptides containing sequences that mimic potential RBD2 substrates

  • Incorporate FRET pairs (e.g., DABCYL and EDANS) flanking the predicted cleavage site

  • Monitor fluorescence increase upon cleavage using excitation/emission wavelengths appropriate for the FRET pair

  • Include controls with known rhomboid inhibitors (e.g., isocoumarin derivatives) to confirm specificity

Gel-Based Substrate Processing:

  • Incubate purified RBD2 with candidate substrate proteins

  • Analyze cleavage products using SDS-PAGE and western blotting

  • Confirm specificity through site-directed mutagenesis of the catalytic residues

  • Compare activity under various conditions (pH, temperature, ionic strength)

Activity Parameters Table:

ParameterOptimal RangeNotes
pH6.5-8.0Most rhomboid proteases function optimally near physiological pH
Temperature25-37°CEnzyme activity and stability balance
Detergent0.5-2× CMCMaintain above critical micelle concentration
Divalent ions1-5 mM MgCl₂ or CaCl₂May enhance activity for some rhomboid proteases

The unique aspect of A. gossypii's secretory pathway response to stress should be considered when evaluating RBD2 activity, as it may function differently from rhomboid proteases in organisms with conventional unfolded protein responses .

How might RBD2 contribute to riboflavin production in A. gossypii?

A. gossypii is well-known for its natural overproduction of riboflavin (vitamin B2), which has led to its industrial use for riboflavin production . The potential relationship between RBD2 and riboflavin production presents an intriguing research question.

Riboflavin production in A. gossypii is influenced by several factors:

  • Oxidative Stress Response: Genomic analysis of riboflavin-overproducing mutants revealed enrichment of mutations in genes involved in oxidation-reduction processes . As a membrane protein, RBD2 might participate in stress signaling or adaptation pathways.

  • Protein Quality Control: RBD2, as a rhomboid protease, likely functions in membrane protein quality control. This could indirectly influence riboflavin production by affecting the turnover of key enzymes or transporters involved in riboflavin biosynthesis .

  • Regulatory Networks: Several genes have been identified as important for riboflavin production in A. gossypii:

    • AgSHM2 (serine hydroxymethyltransferase): Disruption enhances riboflavin production

    • AgSOK2: Involved in both sporulation and riboflavin production

    • Purine biosynthetic pathway genes: Reinforcement improves riboflavin production

Methodological approaches to investigate RBD2's potential role include:

  • Generating RBD2 knockout strains to assess effects on riboflavin production

  • Performing transcriptome analysis to identify correlations between RBD2 expression and riboflavin biosynthesis genes

  • Conducting proteomic studies to identify RBD2 substrates that might influence riboflavin metabolism

  • Investigating interactions between RBD2 and known riboflavin production regulators

Understanding this relationship could potentially inform strategies for enhancing riboflavin production through genetic engineering approaches targeting the protein quality control system of A. gossypii .

What is the relationship between RBD2 and protein secretion stress in A. gossypii?

A. gossypii exhibits an unconventional response to protein secretion stress, which makes understanding RBD2's role particularly interesting. Unlike typical fungal systems, A. gossypii does not activate a conventional unfolded protein response (UPR) under secretion stress conditions, as evidenced by the unchanged expression levels of known UPR target genes (IRE1, KAR2, HAC1, and PDI1 homologs) .

Instead, A. gossypii upregulates genes involved in:

  • Protein unfolding

  • Endoplasmic reticulum-associated degradation (ERAD)

  • Proteolysis

  • Vesicle trafficking

  • Vacuolar protein sorting

  • mRNA degradation

As a putative intramembrane protease, RBD2 may participate in this unconventional stress response through several potential mechanisms:

  • Membrane Protein Quality Control: RBD2 might cleave misfolded membrane proteins as part of the ERAD pathway.

  • Signaling Pathway Activation: Rhomboid proteases often activate signaling pathways by releasing membrane-tethered transcription factors or other signaling molecules.

  • Secretory Pathway Regulation: RBD2 could process proteins involved in vesicle trafficking or sorting.

To investigate these relationships, researchers could employ:

  • Proteomics approaches to identify changes in the abundance and processing of membrane proteins in RBD2 mutants

  • RNA-seq analysis comparing wild-type and RBD2 mutant responses to secretion stress

  • Co-immunoprecipitation studies to identify RBD2 interacting partners during stress conditions

  • Live-cell imaging to track RBD2 localization during normal and stress conditions

The proteins secreted by A. gossypii typically have an isoelectric point between 4 and 6 and a molecular mass above 25 kDa . Researchers should consider these characteristics when investigating potential RBD2 substrates or interaction partners within the secretory pathway.

How can site-directed mutagenesis be used to investigate RBD2 function?

Site-directed mutagenesis offers a powerful approach to dissect the functional domains and catalytic mechanism of RBD2. Based on the conserved features of rhomboid proteases, several key targets for mutagenesis can be identified:

Catalytic Residues:

  • Serine in the conserved GxSx motif (likely the nucleophile)

  • Histidine in the conserved H-x-x-x-(A/S/G) motif (general base)

Substrate-Binding Residues:

  • Hydrophobic residues lining the substrate-binding groove

  • Residues in the recognition motif that determine substrate specificity

Membrane-Association Domains:

  • Hydrophobic residues in transmembrane helices

  • Charged residues at membrane interfaces

Methodological Approach:

  • Design of Mutations:

    • Generate catalytically inactive mutants (e.g., S→A in the catalytic site)

    • Create substrate specificity variants by altering the binding groove

    • Develop expression-optimized variants by modifying membrane anchoring regions

  • Expression and Analysis:

    • Express wild-type and mutant RBD2 in parallel

    • Compare protein stability, localization, and activity

    • Assess effects on cellular phenotypes (growth, stress response, etc.)

  • Structural Interpretation:

    • Map mutations onto predicted structural models

    • Correlate functional effects with structural features

    • Guide design of subsequent mutations

  • In vivo Functional Studies:

    • Complement RBD2 knockout strains with mutant variants

    • Assess rescue of phenotypes (if any)

    • Investigate changes in protein processing and secretory pathway function

A systematic mutagenesis approach, starting with conserved catalytic residues and expanding to putative substrate-binding regions, would provide valuable insights into RBD2's mechanism and biological function within the unique secretory system of A. gossypii .

What strategies can overcome protein aggregation issues when expressing recombinant RBD2?

Membrane proteins like RBD2 are notorious for aggregation during expression and purification. Several strategies can mitigate these challenges:

Expression Optimization:

  • Temperature Reduction: Lower expression temperature (16-25°C) to slow folding and reduce inclusion body formation

  • Induction Modulation: Use lower inducer concentrations for gentler expression

  • Co-expression with Chaperones: Include molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

  • Fusion Partners: N-terminal fusions with solubility-enhancing partners (MBP, SUMO, Trx)

Solubilization Approaches:

  • Detergent Screening: Systematic testing of detergent types and concentrations

    Detergent ClassExampleConcentration RangeNotes
    NonionicDDM, Triton X-1000.5-2%Milder, often preserve activity
    ZwitterionicCHAPS, LDAO0.5-1.5%Intermediate strength
    AnionicSDS0.1-0.5%Harsh, may denature
    Steroid-basedDigitonin0.5-1%Good for protein complexes
  • Detergent Mixtures: Combinations often perform better than single detergents

  • Amphipols: Synthetic amphipathic polymers to stabilize membrane proteins

  • Nanodiscs: Phospholipid bilayers stabilized by scaffold proteins

Buffer Optimization:

  • Stabilizing Additives: Glycerol (5-20%), arginine (50-200 mM), sucrose (5-10%)

  • Salt Concentration: Typically 150-300 mM NaCl, but requires optimization

  • pH Screening: Test range from pH 6.0-8.5 to find stability optimum

  • Reducing Agents: Include DTT or β-mercaptoethanol to prevent disulfide-mediated aggregation

Analytical Approaches:

  • Dynamic Light Scattering: Monitor aggregation state in different conditions

  • Size Exclusion Chromatography: Separate monomeric from aggregated protein

  • Thermal Shift Assays: Identify stabilizing buffer conditions

The unique secretory properties of A. gossypii may provide clues for optimizing RBD2 expression and purification, as this organism has evolved specialized pathways for protein processing .

How can post-translational modifications of RBD2 be characterized?

Characterizing post-translational modifications (PTMs) of RBD2 is essential for understanding its regulation and function. Several complementary approaches can be employed:

Mass Spectrometry-Based Approaches:

  • Bottom-up Proteomics:

    • Enzymatic digestion of purified RBD2

    • LC-MS/MS analysis of peptides

    • Database searching with variable modifications

    • Quantification of modification stoichiometry

  • Top-down Proteomics:

    • Analysis of intact protein

    • Determination of exact molecular weight

    • Fragmentation to localize modifications

    • Especially useful for identifying multiple PTMs on the same molecule

Site-Specific Modification Analysis:

  • Phosphorylation:

    • Phos-tag SDS-PAGE

    • Phospho-specific antibodies (if available)

    • Enrichment using TiO₂ or IMAC

  • Glycosylation:

    • Periodic acid-Schiff (PAS) staining

    • Lectin affinity chromatography

    • Enzymatic deglycosylation (PNGase F, O-glycosidase)

    • Glycan profiling by HILIC-MS

  • Lipidation:

    • Click chemistry with alkyne/azide-modified lipid precursors

    • Hydrophobic chromatography

    • Detergent phase partitioning

Functional Validation:

  • Generate site-directed mutants at putative modification sites

  • Compare activity, localization, and stability of wild-type vs. mutant proteins

  • Assess interactions with binding partners with and without modifications

When studying RBD2 from A. gossypii, researchers should pay particular attention to the secretory pathway-specific modifications, as this fungus has unique properties in protein secretion and stress response . The lack of a conventional unfolded protein response in A. gossypii may impact the post-translational processing of membrane proteins like RBD2 .

What comparative genomic approaches could reveal evolutionary insights about RBD2?

Evolutionary analysis of RBD2 can provide valuable insights into its function and importance. Several approaches can be employed:

Phylogenetic Analysis:

  • Identify RBD2 homologs across fungal species, particularly within Saccharomycetes

  • Construct phylogenetic trees to trace the evolutionary history of rhomboid proteases

  • Compare with other filamentous fungi to identify adaptations specific to A. gossypii

  • Analyze selection pressure on different protein domains

Synteny Analysis:

  • Examine conservation of genomic context around the RBD2 gene

  • Identify co-evolved gene clusters that might indicate functional relationships

  • Compare with the genomic organization in both closely related species (e.g., S. cerevisiae) and more distant fungi

Structural Comparison:

  • Generate structural models of RBD2 homologs from different species

  • Identify conserved catalytic sites and substrate-binding regions

  • Map species-specific variations onto the structural model

  • Predict functional divergence based on structural differences

Correlation with Life History Traits:

  • Compare RBD2 sequence conservation with riboflavin production capacity across species

  • Analyze relationships between RBD2 evolution and filamentous growth patterns

  • Investigate potential correlations with stress response mechanisms

This evolutionary perspective could reveal how RBD2 contributes to the unique biology of A. gossypii, particularly its natural riboflavin overproduction and unconventional stress response mechanisms . The insights gained could guide functional studies and potentially inform biotechnological applications.

How could CRISPR/Cas9 be employed to study RBD2 function in A. gossypii?

CRISPR/Cas9 technology offers powerful tools for investigating RBD2 function in A. gossypii through precise genome editing. Several strategic approaches can be implemented:

Gene Knockout Studies:

  • Design sgRNAs targeting the RBD2 coding sequence

  • Generate complete knockout strains to assess loss-of-function phenotypes

  • Analyze effects on:

    • Growth and morphology

    • Riboflavin production

    • Protein secretion

    • Stress response

Domain-Specific Modifications:

  • Introduce precise mutations in catalytic residues

  • Modify substrate-binding regions

  • Engineer chimeric proteins by swapping domains with homologs

  • Create truncated variants to assess domain functions

Promoter Engineering:

  • Replace native promoter with inducible/repressible systems

  • Create expression gradients to understand dosage effects

  • Generate reporter fusions to monitor expression dynamics

Tagged Variants for Localization and Interaction Studies:

  • C-terminal or internal tagging with fluorescent proteins

  • Addition of affinity tags for pull-down experiments

  • BioID or APEX2 proximity labeling to identify interacting partners

When designing CRISPR/Cas9 experiments in A. gossypii, researchers should consider:

  • The multinucleate nature of A. gossypii hyphae

  • The potential for heterokaryons during transformation

  • The need for selection markers compatible with A. gossypii

  • The unique life cycle, which begins with spore formation and isotropic growth followed by apical growth

The genomic analysis approaches used to study riboflavin-overproducing mutants, which identified mutations in genes involved in oxidation-reduction processes and DNA helicase activity, could inform CRISPR target selection for RBD2 functional studies .

What is the potential for developing RBD2 as a research tool?

Rhomboid proteases like RBD2 hold significant potential as research tools due to their unique properties as intramembrane proteases. Several applications could be developed:

Engineered Proteolytic Systems:

  • Substrate-Specific Reporters:

    • Engineer RBD2 variants with altered specificity

    • Create fluorogenic or bioluminescent substrates

    • Develop sensors for membrane protein dynamics

  • Inducible Protein Degradation:

    • Create chimeric proteins with RBD2 cleavage sites

    • Enable controlled proteolysis of target proteins

    • Develop rapid protein knockdown systems

Biotechnological Applications:

  • Protein Processing Tools:

    • Develop RBD2 as an alternative to TEV protease for membrane proteins

    • Engineer systems for release of membrane-anchored proteins

    • Create regulated secretion systems

  • Engineering A. gossypii:

    • Utilize RBD2 knowledge to enhance recombinant protein production

    • Improve riboflavin production through manipulation of RBD2 and related pathways

    • Develop A. gossypii as an alternative expression system with advantageous secretory properties

Structural Biology Applications:

  • Membrane Protein Crystallization:

    • Employ RBD2 to remove flexible domains that hinder crystallization

    • Develop tools for controlled detergent solubilization

  • Interaction Studies:

    • Use catalytically inactive RBD2 as a trap for substrate identification

    • Develop split-RBD2 complementation assays for membrane protein interactions

The unique secretory pathway and stress response of A. gossypii make RBD2 particularly interesting as a model for understanding alternative protein quality control mechanisms . The natural overproduction of riboflavin by this fungus also suggests potential applications in metabolic engineering .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.