Recombinant Ashbya gossypii Serine palmitoyltransferase-regulating protein TSC3 (TSC3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ashbya gossypii Serine Palmitoyltransferase-Regulating Protein TSC3 (TSC3)

Recombinant TSC3 is a full-length (1–107 amino acids) protein derived from Ashbya gossypii, a filamentous ascomycete. It is produced via heterologous expression in E. coli, with an N-terminal His-tag for purification and detection . TSC3 regulates serine palmitoyltransferase (SPT), the rate-limiting enzyme in sphingolipid biosynthesis, by modulating substrate selectivity between serine and alanine . Its recombinant form is widely used in biochemical and structural studies to investigate SPT activity and lipid metabolism .

Functional Role in SPT Regulation

TSC3 is a critical regulatory subunit of SPT, influencing its substrate preference and enzymatic activity. Key findings include:

  • Substrate Selectivity: TSC3 promotes alanine utilization over serine in SPT-mediated condensation with palmitoyl-CoA .

  • Metabolic Impact:

    • TSC3 knockout strains show reduced alanine incorporation and increased serine influx into sphingolipid biosynthesis .

    • Ypk1-dependent activation of SPT and ceramide synthases compensates for TSC3 loss, leading to elevated serine-derived sphingolipids .

Research Findings and Mechanisms

Experimental Insights from TSC3 Studies

ParameterObservationSource
SPT Substrate UtilizationTSC3 knockout → 50% reduction in alanine incorporation; 2–3× increase in serine flux
Ypk1 ActivationTSC3 deficiency triggers Ypk1-dependent activation of SPT and ceramide synthases
Ceramide SynthesisElevated serine-derived ceramides in tsc3Δ strains; alanine-derived ceramides decrease
Biochemical RoleTSC3 stabilizes SPT’s interaction with alanine, preventing serine dominance

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSC3; AGR026C; Serine palmitoyltransferase-regulating protein TSC3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
TSC3
Target Protein Sequence
MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYY LMTSFDSFCLHVFFLVVFTLSLFGLLKWVLSLYWATVGYMAYAATGQ
Uniprot No.

Target Background

Function
Stimulates the activity of serine palmitoyltransferase (SPT).
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is TSC3 and what is its function in sphingolipid biosynthesis?

TSC3 is a regulatory subunit of Serine Palmitoyltransferase (SPT), the enzyme catalyzing the first and rate-limiting step in sphingolipid biosynthesis. Its primary function involves regulating amino acid substrate selectivity of SPT, specifically promoting alanine utilization by SPT. Research has demonstrated that TSC3 is required for the inhibitory effect of alanine on SPT utilization of serine, creating a critical regulatory mechanism that controls the balance between canonical sphingolipids (derived from serine) and deoxy-sphingolipids (derived from alanine) .

The significance of this regulation lies in the structural differences between these sphingolipid classes. Deoxy-sphingolipids, produced when SPT uses alanine, lack the hydroxyl group at position C1 that is present in canonical sphingolipids. This structural difference prevents deoxy-sphingolipids from being metabolized into complex sphingolipids and can lead to toxicity when they accumulate in cells .

Why is Ashbya gossypii used as an expression system for recombinant proteins?

Ashbya gossypii has emerged as a promising host for recombinant protein production due to several advantageous characteristics that facilitate effective protein expression and recovery. This filamentous fungus can secrete native and heterologous enzymes to the extracellular medium and recognize signal peptides from other organisms as secretion signals . Additionally, A. gossypii can perform protein post-translational modifications, including glycosylation producing N-glycans similar to those produced by non-conventional yeasts like Pichia pastoris .

From a bioprocessing perspective, A. gossypii secretes low amounts and varieties of native proteins and exhibits negligible extracellular protease activity, which facilitates downstream processing and recovery of secreted products . The fungus also demonstrates high genetic tractability with a rich molecular toolbox available for its manipulation and shares remarkable genomic similarities with Saccharomyces cerevisiae, facilitating the transfer of accumulated knowledge about yeast genetics and cell biology .

Industrially relevant attributes include A. gossypii's ability to grow on cheap waste-derived substrates to high cell densities and its demonstrated suitability for use in large-scale industrial fermentation processes, as evidenced by its long history in riboflavin production .

What is the relationship between TSC3, SPT, and sphingolipid metabolism?

SPT catalyzes the condensation of serine or alanine with palmitoyl-CoA to produce 3-ketodihydrosphingosine or 3-ketodeoxysphingosine, respectively, which then enter the sphingolipid biosynthetic pathway. TSC3 functions as a key regulator of this initial step by controlling which amino acid substrate (serine or alanine) is preferentially utilized by SPT .

When TSC3 is knocked out, researchers have observed a significant metabolic shift characterized by decreased incorporation of alanine by SPT and increased influx of serine into the sphingolipid pathway. This shift occurs through Ypk1-dependent activation of both SPT and ceramide synthases, indicating that TSC3 functions within a complex regulatory network involving signaling kinases like Ypk1 .

This regulatory function is critically important because the balance between canonical and deoxy-sphingolipids impacts membrane structure, cell signaling pathways, and cellular stress responses. Disruptions in this balance have been linked to pathological conditions in humans, including hereditary sensory and autonomic neuropathy type 1 (HSAN1), which is associated with mutations that increase SPT's tendency to use alanine .

How does TSC3 relate to Ypk1 signaling pathways?

Ypk1 is a serine/threonine protein kinase regulated by TORC2 (Target of Rapamycin Complex 2) that plays a crucial role in sphingolipid homeostasis. Research has demonstrated that when TSC3 is knocked out, there is increased serine influx into the sphingolipid pathway through Ypk1-dependent activation of both SPT and ceramide synthases .

The Ypk1 protein kinase is activated through phosphorylation at multiple sites, including the activation loop threonine (T504), which is phosphorylated by Pkh1, and the turn motif serine (S644) and hydrophobic motif threonine (T662), which are phosphorylated by TORC2 . These phosphorylation events are essential for Ypk1 function and are regulated in response to various stresses, including sphingolipid depletion and heat shock .

The Ypk1-dependent activation of serine influx after TSC3 knockout suggests a potential feedback loop where deoxy-sphingoid bases (which would decrease with TSC3 loss) normally modulate Ypk1 signaling. This highlights an intricate regulatory network connecting sphingolipid metabolism with TORC2-Ypk1 signaling pathways, representing a novel mechanism for cellular homeostasis maintenance .

What expression vectors and promoters are most effective for recombinant protein production in A. gossypii?

The effectiveness of expression systems in A. gossypii has evolved significantly through systematic optimization. Initial attempts with heterologous proteins using the Saccharomyces cerevisiae PGK1 promoter resulted in very low yields, with subsequent refinements yielding substantial improvements in expression levels .

Removal of the ScADH1 terminator sequence from the initial vector (which had been found to display autonomous replicating sequence activity in A. gossypii) resulted in a 2-fold improvement in protein production. Similar enhancements were also achieved through random mutagenesis of recombinant A. gossypii strains . The most significant improvement came from substituting the ScPGK1 promoter with native A. gossypii promoters (AgTEF and AgGPD), which improved recombinant secretion of β-galactosidase by up to 8-fold .

Table: Comparison of recombinant protein production between A. gossypii and other expression systems

SpeciesProductGenetic BackgroundCulture Conditions OptimizationProduction levelsReference
A. gossypiiEndoglucanase IEngineeredNoUp to 400 μmol/min.L
S. cerevisiaeEndoglucanase IEngineeredNoUp to 1000 μmol/min.L
A. gossypiiβ-galactosidaseEngineeredNoUp to 1127 U/mL
Aspergillus nigerβ-galactosidaseWild TypeNoUp to 3000 U/mL

These comparative data indicate that while A. gossypii currently remains less efficient than S. cerevisiae for some proteins, it approaches production levels of established hosts like A. niger for others. With further optimization of expression vectors, promoters, and culture conditions, A. gossypii shows considerable promise as a competitive recombinant protein production platform .

How can I measure SPT activity and substrate selectivity in experimental settings?

Accurate measurement of SPT activity and substrate selectivity requires sophisticated analytical approaches that can distinguish between serine-derived and alanine-derived sphingolipid products. Based on published methodologies, researchers have developed HPLC-ESI-MS/MS methods to directly quantify condensation products between serine/alanine with palmitoyl-CoA from yeast cultures .

These analytical techniques can be implemented in two complementary ways. First, steady-state measurements can quantify accumulated sphingolipid products, providing a snapshot of SPT activity and substrate preference under specific conditions. Second, real-time monitoring through isotope labeling assays using deuterated L-serine or L-alanine can track the dynamic formation of sphingolipid products, providing insights into reaction kinetics and relative substrate utilization rates .

When implementing these approaches, researchers should consider several methodological factors including sample preparation techniques that efficiently extract sphingolipid species, chromatographic methods that effectively separate canonical and deoxy-sphingolipids, and mass spectrometric parameters optimized for detection of these compounds. Parallel measurement of both serine and alanine incorporation is essential for comprehensive assessment of SPT substrate selectivity, especially when studying regulatory factors like TSC3 .

What culture conditions optimize recombinant protein production in A. gossypii?

Optimization of culture conditions represents a significant opportunity for enhancing recombinant protein production in A. gossypii. Current research has identified several important factors that influence expression levels and could guide further refinement of cultivation protocols .

Carbon source selection has been shown to significantly impact production levels, with glycerol yielding 1.5-fold higher recombinant β-galactosidase production compared to glucose . This suggests that metabolic flux distribution varies substantially between different carbon sources, affecting both growth and protein synthesis. Other nutritional parameters that might be systematically optimized include nitrogen source type and concentration, trace element composition, and vitamin supplementation .

Beyond media composition, expression strategy considerations are equally important. Screening for better promoters (with native A. gossypii promoters like AgTEF and AgGPD already demonstrating superior performance compared to S. cerevisiae promoters) should continue as more genomic information becomes available . Identification of optimal secretion signal sequences and development of integrated stable expression cassettes rather than episomal vectors also represent promising avenues for improvement .

Process parameters such as temperature, pH, dissolved oxygen concentration, and feeding strategies for fed-batch cultivation also warrant systematic investigation to establish optimal conditions for different recombinant proteins. The existing experience with A. gossypii in industrial-scale riboflavin production provides a valuable foundation for these bioprocess optimization efforts .

How can I generate a TSC3 knockout model to study its function?

Generation of a TSC3 knockout model requires precise genetic modification techniques that leverage the high recombination efficiency of fungi like A. gossypii. The recommended approach involves targeted gene disruption through homologous recombination .

The first step involves designing PCR primers that target the TSC3 genomic locus. Based on published protocols, primers should include sequences homologous to regions flanking the TSC3 gene, allowing for precise targeting. Specific primers that have been successfully used include:

  • 5′∼TATATATCTATTATTGCTGTTATCTCCTTTTAGAACCATCTCTGCTTTAATATCATGcataggccactagtggatctg∼3′

  • 5′∼TCCCCTTGCCTCCAGCTTATACTATTATTAACCGAATAAGGATATAAATAATCATgcataggccactagtggatctg∼3′

Using these primers, researchers can generate a PCR product containing a selectable marker flanked by sequences homologous to the TSC3 locus. After transforming the host cells with this PCR product, homologous recombination will integrate the marker at the TSC3 locus, disrupting the gene. Selection on appropriate media will identify transformants containing the integrated marker .

Confirmation of correct integration is crucial and should be performed by PCR with genomic DNA from candidate strains as template. Primers designed to span the junction between genomic DNA and the integrated marker will yield products of predicted size only in correctly integrated transformants . Further verification through phenotypic analysis, such as altered sphingolipid profiles or changes in Ypk1 signaling responses, can provide functional confirmation of successful TSC3 disruption.

How does TSC3 regulate amino acid substrate selectivity in SPT?

The molecular mechanism underlying TSC3's regulation of SPT substrate selectivity represents a fascinating area of ongoing research. Current evidence indicates that TSC3 primarily promotes alanine utilization by SPT, as demonstrated by decreased alanine incorporation into sphingolipids when TSC3 is knocked out . Additionally, TSC3 is required for the inhibitory effect of alanine on SPT utilization of serine, suggesting it may function as a substrate-specific modulator of enzyme activity .

The precise biochemical basis for this regulation remains to be fully elucidated. Several mechanistic hypotheses could explain TSC3's function: it might induce conformational changes in the SPT active site that favor alanine binding over serine; it could act as an allosteric regulator affecting substrate binding or product release; or it might modify enzyme kinetics to alter the relative catalytic efficiencies for different amino acid substrates .

Understanding the structural basis of this regulation would require detailed biochemical and structural studies of the SPT complex with and without TSC3. Techniques such as X-ray crystallography, cryo-electron microscopy, or hydrogen-deuterium exchange mass spectrometry could provide insights into how TSC3 interacts with SPT and modifies its substrate preference. Such studies would not only advance our understanding of sphingolipid metabolism regulation but could also inform the development of modulators that specifically target SPT substrate selectivity for therapeutic applications .

What are the downstream metabolic consequences of TSC3 loss or mutation?

TSC3 knockout induces a complex metabolic reprogramming of sphingolipid biosynthesis with multiple interconnected consequences. The primary metabolic shift involves substrate utilization, with decreased alanine incorporation by SPT and increased serine influx into the sphingolipid pathway . This shift fundamentally alters the balance between canonical and deoxy-sphingolipid species, potentially affecting membrane composition and function.

This metabolic reprogramming occurs through Ypk1-dependent activation of both SPT and ceramide synthases, demonstrating that TSC3 functions within a regulatory network involving signaling kinases . The increased SPT activity with serine leads to enhanced production of 3-ketodihydrosphingosine, which is subsequently reduced to dihydrosphingosine and then acylated by ceramide synthases to form dihydroceramides. These intermediates are further processed to form mature sphingolipids, including ceramides, sphingomyelins, and complex glycosphingolipids .

The signaling implications of these metabolic shifts are particularly intriguing. The Ypk1-dependent activation of sphingolipid biosynthesis in response to TSC3 loss suggests a potential function for deoxy-sphingoid bases in modulating Ypk1 signaling . This indicates a sophisticated feedback mechanism where sphingolipid metabolites regulate the very pathways controlling their synthesis, highlighting the interconnectedness of metabolism and signaling in maintaining cellular homeostasis .

How do the functions of TSC3 in A. gossypii compare to its homologs in other fungi like S. cerevisiae?

Comparative analysis of TSC3 function across fungal species represents an important research direction that could illuminate both conserved and species-specific aspects of sphingolipid metabolism regulation. While direct experimental comparison between A. gossypii TSC3 and S. cerevisiae TSC3 is not fully documented in the current literature, several factors suggest potential functional conservation .

The genomic context provides a strong foundation for functional similarity, as A. gossypii and S. cerevisiae share remarkable genomic similarities that facilitate knowledge transfer between these species . Sphingolipid metabolism, including the core enzymatic machinery of SPT and its regulation, appears broadly conserved across fungi, suggesting that TSC3's regulatory role might be preserved . Additionally, the Ypk1 signaling pathway, which interacts with sphingolipid metabolism and is affected by TSC3 function, is well-characterized in S. cerevisiae and shows considerable conservation in related fungi .

To systematically investigate functional conservation or divergence between A. gossypii TSC3 and its homologs would require complementation studies testing whether S. cerevisiae TSC3 can rescue A. gossypii tsc3Δ phenotypes, and vice versa. Comparative biochemical analysis of purified proteins and evolutionary analysis of protein sequence and structure would further illuminate the degree of functional conservation . These comparative studies would not only advance our understanding of sphingolipid metabolism evolution but could also inform the development of optimal expression systems for recombinant production of TSC3 and related proteins.

What is the role of TSC3 in the regulation of deoxy-sphingolipid production and its impact on Ypk1 signaling?

TSC3 serves as a critical regulator of deoxy-sphingolipid production by promoting alanine utilization by SPT, with significant implications for Ypk1 signaling pathways . When TSC3 is knocked out, alanine utilization decreases, likely reducing deoxy-sphingolipid levels while simultaneously increasing canonical sphingolipid production through enhanced serine utilization .

The relationship between TSC3, deoxy-sphingolipids, and Ypk1 signaling reveals a sophisticated regulatory network. TSC3 knockout leads to Ypk1-dependent activation of serine influx into the sphingolipid pathway, suggesting that deoxy-sphingolipids may normally modulate Ypk1 activity or localization . This observation points to a potential feedback mechanism where deoxy-sphingolipids serve as signaling molecules that regulate Ypk1 function .

The reduced deoxy-sphingolipid production resulting from TSC3 loss may disinhibit Ypk1, leading to increased SPT and ceramide synthase activity . This activation occurs within the context of TORC2-Ypk1 signaling, where Ypk1 is phosphorylated at multiple sites by TORC2, including the turn motif serine (S644) and hydrophobic motif threonine (T662) . These phosphorylation events are essential for Ypk1 function and are regulated in response to various stresses, including sphingolipid depletion and heat shock .

This interplay between TSC3, deoxy-sphingolipids, and Ypk1 signaling highlights the complex integration of sphingolipid metabolism with cellular signaling networks. Understanding this relationship could have significant implications for research on sphingolipid-related disorders like HSAN1, which is associated with mutations in SPT that increase its tendency to use alanine .

Why is my recombinant protein expression low in A. gossypii?

Low recombinant protein expression in A. gossypii can result from several factors related to expression cassette design, integration issues, and culture conditions. Systematic troubleshooting requires consideration of multiple parameters that might limit protein production .

Suboptimal expression cassette design is a common issue. The ScPGK1 promoter has been found to be inefficient in A. gossypii, and the presence of ScADH1 terminator, which displays autonomous replicating sequence activity in A. gossypii, can negatively impact expression . Additionally, inappropriate secretion signal sequences may fail to efficiently direct proteins to the secretory pathway .

Integration issues can also limit expression. Unstable episomal expression rather than genomic integration leads to plasmid loss over time, while integration into suboptimal genomic loci can result in poor expression due to chromatin structure or neighboring regulatory elements . Culture condition limitations represent another important factor, with suboptimal carbon source choice significantly affecting yields (glycerol outperformed glucose by 1.5-fold in some cases) .

Optimization strategies should include replacing ScPGK1 promoter with native A. gossypii promoters like AgTEF or AgGPD, removing the ScADH1 terminator sequence, and developing stable integration cassettes targeting favorable genomic loci . Additionally, screening for optimal secretion signal sequences and systematically optimizing culture media composition and fermentation parameters can yield substantial improvements . These approaches have demonstrated significant enhancements, with up to 8-fold increases in recombinant protein production in some cases .

How can I differentiate between SPT activity with serine versus alanine in my experiments?

Differentiating between SPT activity with serine versus alanine requires sophisticated analytical approaches that can distinguish the resulting sphingolipid products based on their structural differences. HPLC-ESI-MS/MS analysis represents the gold standard for this differentiation, allowing direct measurement of condensation products between serine/alanine with palmitoyl-CoA .

This analytical approach can distinguish products based on mass differences, as deoxy-sphingoid bases (derived from alanine) lack one oxygen compared to canonical sphingoid bases (derived from serine) . This mass difference of 16 Da provides a clear basis for discrimination between these product classes. Chromatographic separation prior to mass spectrometric analysis further enhances the ability to distinguish between these structurally similar compounds .

Isotope labeling strategies provide a powerful complementary approach. Using deuterated L-serine or L-alanine in labeling assays allows monitoring incorporation of labeled amino acids into respective sphingolipid products, with the isotope label providing a distinctive mass signature that can be tracked by mass spectrometry . This approach enables time-course experiments to assess relative rates of amino acid utilization and can reveal subtle changes in substrate preference under different conditions .

Genetic approaches can serve as valuable controls for validating measurement methods. Comparing wild-type versus tsc3Δ strains provides a biological system with known differences in substrate utilization (decreased alanine utilization and increased serine utilization in tsc3Δ), which can be used to verify the sensitivity and accuracy of analytical methods .

What controls should I include in experiments studying TSC3 function?

Robust experimental design for studying TSC3 function requires comprehensive controls that address genetic, metabolic, signaling, and experimental condition variables. These controls ensure that observed phenotypes can be confidently attributed to TSC3 function rather than experimental artifacts or indirect effects .

Genetic controls should include a wild-type strain (positive control), a TSC3 knockout strain (tsc3Δ), and ideally a TSC3 complemented strain (tsc3Δ expressing TSC3 from a plasmid to confirm phenotype rescue) . Additional controls might include strains with mutations in related pathway components (e.g., SPT catalytic subunits) to distinguish TSC3-specific effects from general disruptions of sphingolipid metabolism .

Metabolic measurements should include parallel quantification of both serine and alanine incorporation into sphingolipids, comprehensive profiling of canonical and deoxy-sphingolipid species, and assessment of ceramide levels and species distribution . These measurements provide a detailed view of how TSC3 perturbation affects sphingolipid metabolism at multiple levels .

Signaling pathway controls are essential given the interconnection between TSC3 function and signaling networks. Assessment of Ypk1 activity (as it's implicated in the response to TSC3 loss), monitoring of both SPT and ceramide synthase activities, and analysis of TORC2 signaling components (which regulate Ypk1) provide critical context for interpreting TSC3 function .

Experimental condition controls should include time course experiments to capture dynamic changes, variations in substrate availability (serine/alanine ratios), and stress conditions that activate Ypk1 signaling (e.g., sphingolipid depletion, heat shock) . These variables help establish the physiological context in which TSC3 function is most relevant.

How can I confirm successful integration of my construct into the TSC3 genomic locus?

Confirming successful integration into the TSC3 genomic locus requires a multi-faceted verification approach that combines molecular, functional, and phenotypic analyses. This comprehensive verification strategy ensures that observed phenotypes can be confidently attributed to the specific genetic modification of TSC3 .

PCR-based confirmation represents the primary molecular approach. Primers should be designed to span the junction between the genomic locus and inserted construct, using genomic DNA from candidate strains as template . Correct integration will yield products of predicted size, while incorrect or non-specific integration will produce aberrant products or no amplification .

Functional verification provides complementary evidence through biochemical analysis. Researchers should measure SPT substrate selectivity (expecting decreased alanine utilization and increased serine utilization in TSC3 disruption strains), analyze sphingolipid profiles (looking for increased canonical sphingolipids and decreased deoxy-sphingolipids), and assess Ypk1-dependent activation of sphingolipid biosynthesis .

Additional molecular verification might include Southern blot analysis to confirm single integration at the correct locus, sequencing of the integration junctions to verify precise recombination, and RT-PCR to confirm absence of TSC3 transcripts in knockout strains . Phenotypic verification through growth assays under conditions that challenge sphingolipid metabolism, microscopic examination for characteristic morphological changes, and stress response assays (e.g., heat shock, which activates Ypk1-TORC2 signaling) can provide further confirmation of successful genetic modification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.