Recombinant Ashbya gossypii Solute carrier family 25 member 38 homolog (AGR383W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGR383W; AGOS_AGR383W; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
AGR383W
Target Protein Sequence
MSEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRG TLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY EQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQL QSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLLH
Uniprot No.

Target Background

Function
This protein is a mitochondrial glycine transporter that facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in providing glycine for the first enzymatic step in heme biosynthesis. This step involves the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii and why is it important in biotechnology research?

Ashbya gossypii is a filamentous fungus known for its natural ability to produce high quantities of riboflavin (vitamin B2). This organism has been extensively used for industrial riboflavin production due to its exceptional capacity to synthesize and secrete this vital vitamin . From a research perspective, A. gossypii serves as an important model organism for studying fungal metabolism, protein expression, and biotechnological applications. The significance of A. gossypii stems from its well-characterized genome, established genetic manipulation techniques, and unique metabolic capabilities that make it valuable for both fundamental research and industrial applications.

What is Solute Carrier Family 25 Member 38 Homolog (AGR383W) in Ashbya gossypii?

The Solute Carrier Family 25 Member 38 Homolog (AGR383W) is a 293-amino acid protein that belongs to the SLC25 family of mitochondrial carrier proteins in Ashbya gossypii . SLC25 family members typically function as transporters that facilitate the movement of various metabolites, nucleotides, and other molecules across the inner mitochondrial membrane. Based on its classification, AGR383W likely plays a role in mitochondrial metabolism by mediating the transport of specific substrates between the mitochondrial matrix and the cytosol. While the exact substrate specificity of AGR383W has not been fully characterized, its homology to other SLC25 family members suggests potential involvement in processes related to mitochondrial function and cellular metabolism in A. gossypii.

How can recombinant AGR383W protein be expressed for research purposes?

Recombinant expression of AGR383W can be achieved using bacterial expression systems, particularly E. coli, as evidenced by the availability of His-tagged recombinant protein preparations . The expression methodology typically involves:

  • Gene cloning into an appropriate expression vector containing an N-terminal His-tag

  • Transformation of the construct into a competent E. coli expression strain

  • Culture growth to appropriate density followed by induction of protein expression

  • Cell harvesting and lysis to release the expressed protein

  • Purification using nickel affinity chromatography to capture the His-tagged protein

  • Quality control by SDS-PAGE to verify purity and integrity

  • Lyophilization or storage in an appropriate buffer depending on downstream applications

The purified recombinant protein can then be used for various research purposes including functional characterization, structural studies, and interaction analyses. It's worth noting that as a mitochondrial carrier protein, AGR383W may present expression challenges due to its hydrophobic nature, potentially requiring optimization of expression conditions and purification protocols.

What are the optimal conditions for expressing functional AGR383W protein, and how do they differ from standard protocols?

Expressing functional mitochondrial carrier proteins like AGR383W presents unique challenges due to their hydrophobic nature and complex folding requirements. The optimal conditions often differ significantly from standard recombinant protein expression protocols:

ParameterStandard ProtocolOptimized for AGR383W
Expression hostBL21(DE3) E. coliC41(DE3) or C43(DE3) (specialized for membrane proteins)
Induction temperature37°C18-25°C (to prevent inclusion body formation)
IPTG concentration1.0 mM0.1-0.5 mM (lower concentrations reduce aggregation)
Expression duration4-6 hours16-24 hours (slower expression improves folding)
Media supplementsNoneAddition of glycerol (5-10%) and specific phospholipids
Lysis conditionsHarsh detergentsMilder detergents (DDM, LDAO) or detergent mixes

Additionally, successful expression often requires optimization of the construct design, including:

  • Codon optimization for E. coli

  • Inclusion of solubility-enhancing fusion partners

  • Careful consideration of tag position to avoid interference with protein function

  • Use of specialized vectors designed for membrane protein expression

These modifications are essential for obtaining properly folded and functionally active AGR383W protein suitable for downstream research applications.

What experimental approaches can be used to characterize the substrate specificity of AGR383W?

Determining the substrate specificity of a mitochondrial carrier like AGR383W requires a multi-faceted approach combining various biochemical and cellular techniques:

  • Liposome Reconstitution Assays:

    • Purified AGR383W is reconstituted into liposomes

    • Various potential substrates are loaded into liposomes or added to the external medium

    • Transport activity is measured by monitoring substrate accumulation or efflux

    • This approach directly measures transport function in a controlled environment

  • Mitochondrial Uptake Experiments:

    • Isolation of mitochondria from cells expressing AGR383W

    • Incubation with radiolabeled or fluorescently tagged potential substrates

    • Measurement of substrate accumulation in mitochondria over time

    • Comparison with control mitochondria lacking AGR383W expression

  • Yeast Complementation Studies:

    • Expression of AGR383W in yeast strains deficient in specific mitochondrial transporters

    • Assessment of growth rescue on media requiring specific transporter function

    • This approach provides functional evidence in a cellular context

  • Binding Assays:

    • Isothermal titration calorimetry (ITC) to measure binding affinity to potential substrates

    • Surface plasmon resonance (SPR) to characterize binding kinetics

    • These techniques provide thermodynamic and kinetic parameters of substrate interactions

  • Computational Approaches:

    • Homology modeling based on structurally characterized SLC25 family members

    • Molecular docking simulations with potential substrates

    • Molecular dynamics simulations to assess substrate interaction dynamics

By systematically applying these complementary approaches, researchers can develop a comprehensive understanding of AGR383W substrate specificity and transport mechanism.

How can researchers investigate the relationship between AGR383W function and riboflavin production in Ashbya gossypii?

Investigating the potential relationship between AGR383W function and riboflavin production requires a systematic approach integrating genetic, biochemical, and metabolic analyses:

  • Gene Disruption/Knockout Studies:

    • Creation of AGR383W deletion mutants in A. gossypii

    • Quantification of riboflavin production in mutant vs. wild-type strains under various growth conditions

    • Monitoring of growth characteristics and mitochondrial function in deletion mutants

  • Overexpression Analysis:

    • Generation of strains overexpressing AGR383W

    • Measurement of impact on riboflavin biosynthesis pathway enzymes and metabolites

    • Assessment of changes in mitochondrial function and metabolite profiles

  • Metabolic Flux Analysis:

    • Use of 13C-labeled substrates to trace carbon flow through central metabolism

    • Comparison of metabolic flux distributions between normal and AGR383W-modified strains

    • Identification of metabolic rerouting that may affect riboflavin precursor availability

  • Mitochondrial Function Assessment:

    • Measurement of mitochondrial membrane potential using fluorescent dyes like MitoBright LT Red

    • Assessment of ROS production with ROS-sensitive probes such as ROS Brite 570

    • Evaluation of activities of key mitochondrial enzymes (e.g., NADH dehydrogenase, succinate dehydrogenase)

  • Integration with Known Riboflavin Production Factors:

    • Examination of interactions between AGR383W function and acetohydroxyacid synthase activity, which has been implicated in riboflavin production

    • Investigation of how AGR383W affects branched-chain amino acid metabolism, which influences riboflavin production

    • Analysis of potential connections to mitochondrial redox balance, known to impact riboflavin synthesis

This multi-faceted approach would provide insights into whether and how AGR383W influences riboflavin production pathways in A. gossypii, potentially identifying new strategies for enhancing vitamin production.

How does the function of AGR383W potentially relate to mitochondrial metabolism in Ashbya gossypii?

As a member of the Solute Carrier Family 25, AGR383W likely plays a crucial role in mitochondrial metabolism by facilitating the transport of specific metabolites across the inner mitochondrial membrane. Several potential functional roles can be hypothesized:

Understanding the specific function of AGR383W would provide valuable insights into mitochondrial metabolism in A. gossypii and potentially reveal novel connections between mitochondrial transport processes and specialized metabolism, including riboflavin production.

What structural biology approaches can be applied to understand AGR383W transport mechanism?

Elucidating the structural basis of AGR383W transport mechanism requires application of various complementary structural biology techniques, each with specific advantages:

  • X-ray Crystallography:

    • Expression and purification of AGR383W in detergent micelles or lipidic cubic phase

    • Crystallization trials with various detergents, lipids, and stabilizing agents

    • Structure determination at different states (e.g., substrate-bound, transition states)

    • This approach can provide high-resolution structural information, though membrane protein crystallization remains challenging

  • Cryo-Electron Microscopy (Cryo-EM):

    • Preparation of AGR383W in detergent micelles, nanodiscs, or amphipols

    • Vitrification and imaging using high-resolution cryo-EM

    • Single-particle analysis and 3D reconstruction

    • Particularly valuable for capturing different conformational states without crystallization

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Expression of isotopically labeled AGR383W

    • Solution NMR for dynamic regions or solid-state NMR for the entire protein

    • Analysis of substrate binding and conformational changes

    • Especially useful for studying protein dynamics during the transport cycle

  • Molecular Dynamics (MD) Simulations:

    • Development of computational models based on homology or experimental structures

    • Simulation of protein behavior in a lipid bilayer environment

    • Investigation of substrate binding, translocation pathway, and conformational changes

    • Provides insights into transport mechanisms at atomistic resolution

  • Site-Directed Spin Labeling (SDSL) with Electron Paramagnetic Resonance (EPR):

    • Introduction of spin labels at specific positions in AGR383W

    • Measurement of distances between labeled sites in different states

    • Monitoring conformational changes during transport cycle

    • Useful for validating computational models and mapping dynamic regions

By integrating data from these complementary approaches, researchers can develop a comprehensive understanding of how AGR383W recognizes, binds, and translocates its substrates across the mitochondrial inner membrane, providing mechanistic insights into its function in A. gossypii metabolism.

How might mutations in AGR383W affect mitochondrial function and riboflavin production?

Mutations in AGR383W could potentially influence mitochondrial function and riboflavin production through several mechanisms, based on our understanding of mitochondrial carrier proteins and the metabolic networks in A. gossypii:

  • Altered Substrate Specificity: Mutations may modify the substrate binding pocket, changing which metabolites are transported across the mitochondrial membrane. This could redirect metabolic flux either toward or away from riboflavin precursors, depending on the specific changes.

  • Modified Transport Kinetics: Mutations affecting the transport mechanism could alter the rate of substrate translocation, potentially creating bottlenecks or enhancing flux through specific metabolic pathways connected to riboflavin biosynthesis.

  • Impact on Mitochondrial Membrane Potential: Research has shown that riboflavin-overproducing mutants exhibit decreased mitochondrial membrane potential . Mutations in AGR383W might contribute to this phenomenon if they affect the electrochemical gradient across the inner mitochondrial membrane.

  • Influence on ROS Production: Riboflavin-overproducing strains demonstrate increased ROS production . Mutations in AGR383W could potentially influence redox balance by altering the transport of metabolites involved in antioxidant systems or by affecting electron transport chain function.

  • Interaction with Branched-Chain Amino Acid Metabolism: Given the established importance of acetohydroxyacid synthase and branched-chain amino acids in riboflavin production , mutations in AGR383W that affect related metabolite transport could significantly impact riboflavin biosynthesis.

Experimental approaches to investigate these effects should include:

  • Comparative analysis of mitochondrial function in wild-type versus mutant strains

  • Measurement of key metabolite levels in different cellular compartments

  • Assessment of riboflavin production capacity under various growth conditions

  • Analysis of transcriptional and metabolic responses to AGR383W mutations

Understanding how specific mutations in AGR383W affect these parameters would provide valuable insights into both mitochondrial carrier protein function and the metabolic networks underlying riboflavin production in A. gossypii.

How does AGR383W compare to homologous proteins in other fungi and model organisms?

Comparative analysis of AGR383W with homologs in other organisms provides valuable insights into its evolutionary conservation, functional specialization, and potential role in Ashbya gossypii:

  • Sequence Conservation Patterns:

    • The 293-amino acid sequence of AGR383W contains characteristic mitochondrial carrier protein features

    • Six transmembrane domains likely form the typical "three-repeat" structure of mitochondrial carriers

    • Signature motifs such as PX[DE]XX[KR] are typically conserved across species but may show fungal-specific variations

  • Functional Homology:

    • Based on sequence similarity, AGR383W may be functionally related to SLC25A38 in humans, which transports glycine and is involved in heme biosynthesis

    • In Saccharomyces cerevisiae, the closest homolog likely performs a similar mitochondrial transport function but may have different substrate specificity reflecting the differing metabolic requirements

  • Evolutionary Adaptation:

    • A. gossypii's specialized metabolism for riboflavin overproduction may have driven unique adaptations in its mitochondrial carriers

    • Comparative analysis may reveal A. gossypii-specific features in AGR383W that support this specialized metabolism

A comparative overview of potential homologs might include:

OrganismHomologPredicted FunctionRelation to Metabolism
S. cerevisiaeYDL119cMitochondrial carrierCentral metabolism
N. crassaNCU02780Mitochondrial transporterFilamentous fungal metabolism
A. nidulansAN4557Putative carrier proteinSecondary metabolism
H. sapiensSLC25A38Glycine transporterHeme biosynthesis
M. musculusSlc25a38Glycine transportErythropoiesis

This comparative approach highlights both evolutionarily conserved features essential for fundamental transport function and lineage-specific adaptations that may relate to A. gossypii's unique metabolism, including its capacity for riboflavin overproduction.

What insights can be gained from comparing wild-type and mutant versions of AGR383W in different Ashbya gossypii strains?

Systematic comparison of AGR383W between wild-type A. gossypii and riboflavin-overproducing mutant strains could reveal important insights into its potential role in metabolism and riboflavin production:

  • Sequence Variation Analysis:

    • Identification of natural variants or mutations in the AGR383W gene among different strains

    • Determination of whether mutations affect conserved functional domains

    • Correlation of specific sequence changes with riboflavin production phenotypes

  • Expression Pattern Differences:

    • Quantification of AGR383W transcript and protein levels across strains

    • Analysis of whether expression changes correlate with riboflavin production capacity

    • Identification of potential regulatory mechanisms affecting AGR383W expression

  • Mitochondrial Physiology Correlation:

    • Assessment of how AGR383W variants correlate with observed differences in mitochondrial membrane potential between wild-type and mutant strains

    • Investigation of the relationship between AGR383W function and ROS production, which is elevated in riboflavin-overproducing strains

    • Examination of potential links to activities of mitochondrial dehydrogenases, which show altered function in riboflavin-overproducing strains

  • Metabolic Impact Assessment:

    • Comparison of metabolite profiles in strains with different AGR383W variants

    • Special focus on metabolites related to branched-chain amino acid metabolism, which affects riboflavin production

    • Analysis of how AGR383W variants might influence the distribution of key metabolites between mitochondria and cytosol

This comparative approach would help establish whether AGR383W contributes to the metabolic adaptations observed in riboflavin-overproducing strains of A. gossypii, potentially identifying it as a target for metabolic engineering efforts aimed at enhancing riboflavin production.

What technical challenges exist in studying mitochondrial carrier proteins like AGR383W, and how can they be addressed?

Studying mitochondrial carrier proteins like AGR383W presents several technical challenges that require specialized approaches:

  • Protein Expression and Purification Challenges:

    • Hydrophobic nature makes heterologous expression difficult

    • Tendency to form inclusion bodies or aggregate

    • Potential toxicity to expression hosts

    Solutions:

    • Use of specialized expression strains (C41/C43, Lemo21)

    • Expression at lower temperatures (16-25°C)

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Codon optimization and careful construct design

    • Screening multiple detergents for optimal extraction and stability

  • Functional Assay Limitations:

    • Difficulty in establishing physiologically relevant transport assays

    • Challenges in distinguishing specific from non-specific transport

    • Complex substrate specificity determination

    Solutions:

    • Development of liposome reconstitution systems with controlled lipid composition

    • Use of radiolabeled or fluorescently labeled substrates for sensitive detection

    • Implementation of counter-flow assays for transport mechanism studies

    • Development of high-throughput screening approaches for substrate identification

  • In Vivo Functional Assessment:

    • Redundancy among mitochondrial carriers may mask phenotypes

    • Difficulties in monitoring mitochondrial metabolite levels in vivo

    • Challenges in isolating specific carrier effects from general mitochondrial dysfunction

    Solutions:

    • Creation of multiple carrier knockouts to address redundancy

    • Development of targeted metabolomic approaches for mitochondrial metabolites

    • Use of organelle-specific sensors for real-time monitoring

    • Complementation studies in defined genetic backgrounds

Overcoming these challenges requires an integrated approach combining advanced molecular biology techniques, specialized expression systems, and sophisticated functional assays, but can yield valuable insights into the function of mitochondrial carrier proteins like AGR383W and their roles in cellular metabolism.

How can the role of AGR383W in mitochondrial metabolism be integrated with our understanding of riboflavin production pathways?

Integrating AGR383W function into the broader context of mitochondrial metabolism and riboflavin production requires a systems biology approach that connects several key pathways:

  • Metabolic Network Mapping:

    • Construction of a comprehensive metabolic model incorporating mitochondrial transport processes

    • Integration of known riboflavin biosynthetic pathways with central carbon metabolism

    • Identification of potential metabolic connections between AGR383W-mediated transport and riboflavin precursor synthesis

  • Mitochondrial-Cytosolic Metabolite Exchange:

    • Previous research has established that mitochondrial dysfunction correlates with riboflavin overproduction in A. gossypii

    • AGR383W likely mediates the transport of metabolites between mitochondria and cytosol, potentially affecting the distribution of riboflavin precursors

    • Analysis of how altered mitochondrial transport might influence metabolic flux toward riboflavin

  • Redox Balance Connections:

    • Riboflavin-overproducing strains exhibit increased ROS production and altered mitochondrial membrane potential

    • AGR383W may transport metabolites involved in maintaining redox balance

    • Investigation of how AGR383W function influences cellular redox state and consequent effects on riboflavin production

  • Branched-Chain Amino Acid Metabolism:

    • Research has demonstrated that acetohydroxyacid synthase activity and branched-chain amino acids significantly impact riboflavin production

    • AGR383W might transport related metabolites between cellular compartments

    • Examination of potential regulatory connections between mitochondrial transport and branched-chain amino acid metabolism

  • Integrated Experimental Approach:

    • Combined transcriptomic, proteomic, and metabolomic analysis of wild-type versus AGR383W-modified strains

    • Flux analysis to quantify changes in metabolic pathways

    • Correlation of AGR383W function with key parameters of mitochondrial physiology and riboflavin production

This integrated approach would help establish the precise role of AGR383W in A. gossypii metabolism and its potential contributions to the organism's capacity for riboflavin overproduction, potentially identifying new targets for metabolic engineering to enhance vitamin production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.