Recombinant Ashbya gossypii Spore membrane assembly protein 2 (SMA2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant SMA2

Recombinant SMA2 is derived from Ashbya gossypii, a filamentous fungus widely studied for industrial biotechnology. Key molecular features include:

PropertyDetails
UniProt IDQ756X9
Gene NameSMA2 (AER135W)
Expression SystemEscherichia coli
TagUndisclosed (determined during production)
Amino Acid Sequence385 residues (1-385) with specific domains for membrane association
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

The full-length protein contains conserved domains involved in spore membrane assembly, including hydrophobic regions critical for lipid interactions .

Functional Role in Sporulation

SMA2 is integral to prospore membrane formation during fungal sporulation. Key findings include:

  • Localization: SMA2 localizes to the prospore membrane as an integral membrane protein, facilitating membrane curvature and vesicle fusion .

  • Structural Role: Its α-helical domains interact with lipid bilayers, enabling structural stabilization during spore development .

  • Homology: Shares functional conservation with Saccharomyces cerevisiae SMA2, which is essential for sporulation efficiency .

Mechanistic Insights:

  • SMA2 collaborates with Spo20p to regulate membrane expansion during meiosis.

  • Disruption of SMA2 homologs in yeast leads to defective spore walls, highlighting evolutionary conservation .

Expression and Purification

  • Host System: Optimized in E. coli for high-yield production (>90% purity via SDS-PAGE) .

  • Reconstitution: Lyophilized powder is reconstituted in sterile water (0.1–1.0 mg/mL) with glycerol for stability .

Engineering Challenges

  • Secretion Optimization: While A. gossypii is a robust host for riboflavin, recombinant protein secretion (e.g., SMA2) requires strain engineering, such as promoter replacement (e.g., PGPD1) or GAS1 gene deletion to enhance extracellular yields .

Applications in Research and Industry

  • Model Studies: Used to dissect sporulation mechanisms in fungi, with implications for developmental biology .

  • Industrial Relevance: A. gossypii's genetic tractability makes SMA2 a candidate for metabolic engineering pipelines, particularly in lipid production and enzyme secretion .

Comparative Analysis of SMA2 Homologs

FeatureAshbya gossypii SMA2 Saccharomyces cerevisiae SMA2
Length385 residues392 residues
LocalizationProspore membraneProspore membrane
Essential forMembrane assemblySpore wall integrity
Expression HostE. coliNative yeast

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve SMA2-lipid interactions.

  • Strain Optimization: Leveraging strong promoters (e.g., PCCW12) to enhance SMA2 yields in A. gossypii .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMA2; AER135W; Spore membrane assembly protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
SMA2
Target Protein Sequence
MGSRLLQFQSYGKWFMLLSLATAICLLHLPSYSCTYSRDLPICTPQVSFQLTNTTPTATL FLSTVKEVSMLLSYVAIDLGWNVNFPKPNDYDTSNLVNTFDPSNKYHVNLFGYCKWQPLS NKATWYCMDNPNGLDIISMIVRDLGAQLGVLSHTNTKILSDSLWILYRSIFDSFYKFVHD DDYRADKVASFLQSLQQGGPLPSVDQFKTVTLLLKCFEKLTNAIQVTELCSFALIIIAIA LATVACVMDILAAREEKHSATSDKLPKALFFKQITLKLSYAVVTCSLFYQIGMAVYFLAL FSIRYPYDYKVKVMTFNPDTGYWLSVLRFVMEFWFAVACYIGLSLSRRRPSKEVDDLDWK DEEQTPDSGETAICVSTRGSTRIQV
Uniprot No.

Target Background

Function
This protein is involved in spore and ascus formation. It is essential for the efficient assembly of prospore membrane precursors into a continuous prospore membrane.
Database Links
Protein Families
SMA2 family
Subcellular Location
Prospore membrane; Multi-pass membrane protein.

Q&A

What is the role of SMA2 in Ashbya gossypii spore formation?

SMA2 is hypothesized to be involved in the distinctive needle-shaped spore formation process in Ashbya gossypii. The spores of A. gossypii have a characteristic needle shape with an average length of approximately 30 μm and a diameter of about 1 μm at the widest part . This unique morphology is likely an adaptation for transmission by sucking insects . Similar to other proteins involved in spore formation, SMA2 may participate in the cytoskeletal organization during sporulation. Research on related proteins has shown that spore formation in A. gossypii relies heavily on actin and actin regulatory proteins, which is distinct from the minor role actin plays in Saccharomyces cerevisiae spore formation .

How does SMA2 compare structurally and functionally to other spore membrane assembly proteins in filamentous fungi?

While specific comparative studies of SMA2 across filamentous fungi are ongoing, research on spore formation proteins in A. gossypii has revealed interesting parallels to the meiotic outer plaque proteins in S. cerevisiae. For instance, proteins like AgSpo74, AgMpc54, and AgAdy4 (homologs to S. cerevisiae meiotic outer plaque proteins) have been identified and characterized in A. gossypii . Deletion studies have shown that AgSpo74 is essential for spore formation, as the deletion mutant produces no detectable spores . Similarly, SMA2 may share functional domains with these proteins while having evolved specialized functions for the distinctive needle-shaped spores of A. gossypii. Structural analysis through protein modeling and sequence alignment with related proteins can provide insights into conserved domains and potential functional sites.

What expression patterns does SMA2 exhibit during different phases of the A. gossypii life cycle?

Expression analysis of proteins involved in A. gossypii sporulation indicates that spore-related proteins show regulated expression patterns tied to developmental stages. Based on studies of similar proteins, SMA2 expression likely increases during the transition from vegetative growth to sporulation. Research techniques for monitoring expression include RT-qPCR, RNA-seq, and reporter gene assays. The Dual Luciferase Reporter (DLR) Assay has been successfully adapted for analyzing promoter activity in A. gossypii using integrative cassettes . This technique could be applied to characterize the promoter region of SMA2 and determine its regulation during different growth phases and under various environmental conditions.

What are the most effective methods for recombinant expression and purification of A. gossypii SMA2?

For recombinant expression of A. gossypii proteins, several promoter systems have been characterized that offer different expression levels and regulatory properties. Strong constitutive promoters such as PCCW12, PSED1, and other newly identified promoters can drive high-level expression of recombinant proteins in A. gossypii . For controlled expression, carbon source-regulatable promoters are also available .

The purification strategy should be designed based on the protein's properties, but generally includes:

  • Construction of expression vectors with appropriate promoters and fusion tags

  • Transformation into A. gossypii using established protocols

  • Optimized culture conditions for protein expression

  • Cell lysis under conditions that maintain protein stability and activity

  • Multi-step purification using affinity chromatography followed by size exclusion or ion exchange chromatography

  • Verification of purity by SDS-PAGE and Western blotting

For functional studies, it's crucial to verify that the recombinant protein retains its native activity after purification.

How can one effectively visualize SMA2 localization during spore formation in A. gossypii?

Based on studies of other spore-related proteins in A. gossypii, fluorescent protein tagging followed by confocal microscopy provides powerful insights into protein localization during sporulation. In vivo protein localization can be achieved by:

  • Generating SMA2-fluorescent protein fusions (GFP, mCherry, etc.) using genomic integration techniques

  • Confirming functional integrity of the fusion protein through complementation assays

  • Time-lapse microscopy to track dynamic localization during sporulation

  • Co-localization studies with known spore formation markers

Researchers have successfully used in vivo FRET measurements of proteins labeled with fluorescent proteins to investigate protein interactions during sporulation in A. gossypii . This approach could be adapted to study SMA2 interactions with other proteins involved in spore formation. For higher resolution imaging, super-resolution microscopy techniques like STED or STORM could reveal more detailed localization patterns.

What gene editing strategies are most efficient for studying SMA2 function in A. gossypii?

For genetic manipulation of A. gossypii, several approaches have proven effective:

  • Homologous recombination-based gene deletion or modification:

    • PCR-based targeting modules with selectable markers

    • Transformation of linear DNA fragments with flanking homology regions

    • Verification of correct integration by PCR, Southern blotting, and phenotypic analysis

  • CRISPR-Cas9 system adapted for A. gossypii:

    • Design of guide RNAs targeting specific regions of SMA2

    • Co-transformation with donor DNA for precise mutations or insertions

    • Screening of transformants for desired modifications

  • Conditional expression systems:

    • Promoter replacement with regulatable promoters

    • Implementation of degron-based approaches for controlled protein degradation

When studying essential genes, construction of temperature-sensitive alleles or partial deletions may be necessary to maintain viability while exploring function. For phenotypic characterization of mutants, microscopic examination of spore morphology, sporulation efficiency, and spore viability are critical measurements .

How does SMA2 interact with the spindle pole body during A. gossypii sporulation?

Research on spore formation in A. gossypii has revealed that the spindle pole body (SPB) serves as an organizing center for spore development. Proteins like the formin AgBnr2, which promotes actin polymerization, integrate into the SPB structure during sporulation . Similar to AgBnr2, SMA2 may interact with SPB components, particularly with structures analogous to the meiotic outer plaque of S. cerevisiae.

To investigate SMA2 interactions with the SPB, researchers could employ:

  • Yeast two-hybrid or split-ubiquitin assays to screen for binding partners

  • Co-immunoprecipitation followed by mass spectrometry to identify interacting proteins

  • FRET analysis with fluorescently tagged proteins to confirm interactions in vivo

  • Structural biology approaches to determine binding interfaces

Previous FRET-based studies demonstrated that AgBnr2 shows highest FRET with AgSpo74, indicating a close physical interaction . AgSpo74 serves as a main factor for targeting AgBnr2 to the SPB . Similar experimental approaches could determine if SMA2 exhibits comparable interactions with these or other SPB components.

What is the relationship between SMA2 and actin cytoskeleton organization during sporulation?

A. gossypii spore formation depends significantly on actin and actin regulatory proteins, unlike in S. cerevisiae where actin plays a minor role . Formins like AgBnr2 promote actin polymerization and are important for shaping the distinctive needle-shaped spores . SMA2 may coordinate with these actin regulators during spore membrane assembly.

To investigate the relationship between SMA2 and the actin cytoskeleton:

  • Co-localization studies of SMA2 with actin and actin-binding proteins during sporulation

  • Analysis of actin organization in SMA2 mutants using fluorescent phalloidin staining

  • In vitro assays to test direct effects of purified SMA2 on actin polymerization or bundling

  • Synthetic genetic interaction screening to identify genetic relationships with actin cytoskeleton genes

Research has shown that proteins like AgBni1, AgRho1a, AgRho1b, and AgPxl1 are important factors for spore morphology in A. gossypii . Examining the genetic and physical interactions between SMA2 and these known morphology determinants would provide insights into the mechanisms of spore membrane assembly.

How do environmental factors influence SMA2 expression and activity during sporulation?

Environmental conditions significantly impact sporulation in fungi, likely affecting SMA2 expression and function. To investigate these relationships, researchers could:

  • Perform transcriptomic and proteomic analyses under various sporulation-inducing conditions

  • Analyze SMA2 promoter activity using reporter assays in response to different nutrients, stressors, and signaling molecules

  • Examine post-translational modifications of SMA2 under varying conditions using mass spectrometry

  • Create SMA2 variants with mutations at potential modification sites to test functional consequences

Previous studies on A. gossypii have identified promoters with carbon source-regulatable abilities that improve gene expression platforms . Similar regulatory mechanisms might control SMA2 expression during sporulation in response to specific environmental triggers.

How can contradictory data regarding SMA2 localization be reconciled?

When faced with contradictory data about SMA2 localization during sporulation, consider the following approaches:

  • Timing considerations: Localization patterns may change dramatically during different stages of sporulation. Implement time-course experiments with frequent sampling to capture transient localization events.

  • Technical variables:

    • Compare results from different fixation methods (if applicable)

    • Test multiple fluorescent protein tags at both N- and C-termini

    • Validate with antibody-based detection if available

    • Use complementary approaches like subcellular fractionation

  • Biological context:

    • Examine localization in different genetic backgrounds

    • Consider the influence of environmental conditions

    • Test whether localization depends on specific binding partners

  • Resolution limits:

    • Employ super-resolution microscopy for more detailed localization

    • Use electron microscopy with immunogold labeling for highest resolution

Discrepancies in protein localization data can provide valuable insights into protein dynamics and regulation when systematically investigated.

What are the common pitfalls in functional studies of A. gossypii SMA2 and how can they be avoided?

Common challenges in studying A. gossypii SMA2 function include:

  • Genetic manipulation issues:

    • Inefficient transformation: Optimize protoplast preparation, DNA concentration, and regeneration conditions

    • Off-target effects: Verify specificity of genetic modifications through complementation and whole-genome sequencing

    • Phenotypic heterogeneity: Use single-spore isolation to establish genetically homogeneous cultures

  • Protein expression problems:

    • Low expression levels: Test different promoters from the A. gossypii molecular toolbox

    • Protein instability: Optimize extraction buffers and include appropriate protease inhibitors

    • Misfolding: Consider expression at lower temperatures or as fusion with solubility-enhancing tags

  • Functional assay limitations:

    • Variability in sporulation: Standardize culture conditions and use quantitative measures of sporulation efficiency

    • Differentiating direct from indirect effects: Employ rapid induction or inactivation systems to identify immediate consequences of SMA2 perturbation

    • Background strain effects: Test phenotypes in multiple genetic backgrounds

Careful experimental design with appropriate controls and validation through multiple independent approaches can overcome many of these challenges.

How can one distinguish between direct and indirect effects of SMA2 perturbation on A. gossypii sporulation?

Distinguishing direct from indirect effects of SMA2 perturbation requires careful experimental design:

  • Temporal analysis:

    • Use rapid induction/repression systems or conditional alleles

    • Monitor earliest detectable consequences of SMA2 perturbation

    • Establish a timeline of events following SMA2 disruption

  • Proximity-based approaches:

    • Implement BioID or APEX proximity labeling to identify proteins in close physical proximity to SMA2

    • Perform ChIP-seq if SMA2 might have DNA-binding properties

    • Use crosslinking mass spectrometry to capture direct binding partners

  • In vitro reconstitution:

    • Test whether purified SMA2 can directly affect relevant biochemical processes

    • Reconstitute minimal systems with defined components to test specific activities

  • Genetic bypass experiments:

    • Test whether constitutive activation of suspected downstream factors can bypass the need for SMA2

    • Perform genetic suppressor screens to identify compensatory mutations

Combining these approaches can provide strong evidence for distinguishing direct functions from downstream consequences of SMA2 activity.

How might SMA2 function be integrated into metabolic engineering applications in A. gossypii?

A. gossypii has been established as a valuable platform for metabolic engineering and the production of various compounds . Understanding SMA2's role in sporulation could have implications for metabolic engineering applications:

  • Sporulation control for production stability:

    • Engineering SMA2 to regulate sporulation timing could enhance production strain stability

    • Creating non-sporulating strains through SMA2 modification might be beneficial for continuous cultivation

  • Membrane engineering:

    • Insights from SMA2's role in spore membrane assembly could inform strategies for modifying membrane composition for improved product export or stress tolerance

    • Targeting SMA2-related pathways might alter membrane properties to enhance bioproduction

  • Leveraging sporulation-associated promoters:

    • The SMA2 promoter or other sporulation-associated promoters could be repurposed for controlled expression of metabolic pathways

    • Creating switchable production systems tied to sporulation phases

  • Spore-based biocatalysts:

    • Engineering SMA2 to create spores with desired catalytic properties embedded in their structure

    • Developing spore-based delivery systems for enzymes or bioactive compounds

The recent development of A. gossypii as a platform for producing compounds like sabinene (achieving titers of 684.5 mg/L) demonstrates its potential for industrial applications, which could be further enhanced through sporulation engineering.

What comparative genomics approaches can reveal about SMA2 evolution across fungal lineages?

Comparative genomics approaches can provide valuable insights into SMA2 evolution and function:

  • Phylogenetic analysis:

    • Constructing phylogenetic trees of SMA2 homologs across fungal species

    • Mapping sporulation morphology traits onto phylogenetic trees to identify correlations with SMA2 sequence features

    • Calculating selection pressures (dN/dS ratios) across different protein domains

  • Structural prediction and comparison:

    • Using AlphaFold or similar tools to predict structures of SMA2 homologs

    • Comparing predicted structures to identify conserved functional domains

    • Mapping sequence conservation onto structural models to identify crucial regions

  • Synteny analysis:

    • Examining gene neighborhoods around SMA2 across species

    • Identifying co-evolved gene clusters that might function together

  • Experimental verification:

    • Testing functional complementation of SMA2 homologs from diverse species

    • Creating chimeric proteins to map functionally important domains

The distinct needle shape of A. gossypii spores (30 μm length, 1 μm diameter) suggests specialized adaptations in spore formation machinery, potentially including unique features in SMA2 that could be identified through comparative approaches.

How might systems biology approaches enhance our understanding of SMA2's role in the sporulation network?

Systems biology approaches can provide a holistic view of SMA2's function within the broader sporulation network:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, metabolomics, and lipidomics data during sporulation

    • Constructing gene regulatory networks centered around SMA2

    • Identifying metabolic shifts associated with SMA2 activity

  • Mathematical modeling:

    • Developing predictive models of sporulation incorporating SMA2 function

    • Simulating the effects of SMA2 perturbation on spore development

    • Creating morphogenetic models of spore shape determination

  • Network analysis:

    • Identifying central hubs and motifs in the sporulation network

    • Mapping genetic and protein interaction networks related to SMA2

    • Comparing network architectures across fungal species with different spore morphologies

  • Single-cell approaches:

    • Analyzing cell-to-cell variability in SMA2 expression and localization

    • Correlating single-cell measurements with sporulation outcomes

    • Tracking lineage relationships during sporulation

Such approaches could reveal how SMA2 coordinates with other factors like AgBnr2, AgSpo74, and actin regulatory proteins to orchestrate the complex process of spore formation in A. gossypii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.