Recombinant Ashbya gossypii Squalene synthase (ERG9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
ERG9; AFR444C; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-441
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
ERG9
Target Protein Sequence
MGKVVQLFTHPLELKAALKLKFLREPLYPADDTQGSAELKRCYQLLQRTSRSFAAVIMEL HPELRNAVMLFYLILRALDTVEDDMTISPKVKVPLLREFDQKLKLDTWSFDGNAKTEKDR DVLVEFSTILAEFHKLKPEYQQVIADITHKMGNGMADYILDEKFNLSGLETIQDYDRYCH YVAGLVGDGLTHLIMLAKFSSPGLYYDSPDLYESMGLFLQKTNIIRDYAEDLADGRSFWP KEIWSHYADDLASFSKPENATAGVYCINHLVLNALGHVQHVLTYLASLREQSSFQFCAIP QVMAIATLALVFGNERVLQTSVKIRKGTTCYLILKSRTFQGCVEIFEHYLRDIRKRLTVA DPNYLKLNIEIAKLDKFIEEMYQDKLPVGAKPQETEIYKKVRERSAYDLEVLPREQEEEF KFNVLLSILFTVFGALYWYAK
Uniprot No.

Target Background

Function
Recombinant *Ashbya gossypii* Squalene Synthase (ERG9) catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene. This enzyme is crucial in the sterol biosynthesis pathway, initiating ergosterol biosynthesis.
Database Links
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Ashbya gossypii Squalene synthase (ERG9) and what is its role in terpene biosynthesis?

Ashbya gossypii Squalene synthase (ERG9) is a key enzyme in the isoprenoid biosynthetic pathway, catalyzing the first committed step in sterol biosynthesis. Functionally, it converts two molecules of farnesyl pyrophosphate (FPP) to squalene through a reductive dimerization reaction. The enzyme plays a critical role in the branching point of isoprenoid metabolism, diverting carbon flux from the production of other terpenes (monoterpenes, sesquiterpenes) toward sterol synthesis .

The ERG9 gene from A. gossypii has been identified as ordered locus AFR444C, encoding a protein with EC classification 2.5.1.21. Alternative designations include FPP:FPP farnesyltransferase and Farnesyl-diphosphate farnesyltransferase .

How does ERG9 expression affect monoterpene production in A. gossypii?

ERG9 expression directly impacts monoterpene production by competing for the key precursor FPP. Recent studies have demonstrated that engineered A. gossypii strains can effectively produce various plant monoterpenes including sabinene, limonene, pinene, and linalool . The regulation of ERG9 is critical for redirecting metabolic flux toward monoterpene production.

Researchers have employed two key strategies to enhance monoterpene synthesis:

  • Introduction of a mutant erg20 allele with reduced FPP synthase activity

  • Implementation of an orthogonal NPP (neryl pyrophosphate) synthase pathway

These modifications allow terpene synthases to utilize alternative substrates for monoterpene production, reducing competition with the ERG9-mediated sterol pathway .

What are the recommended protocols for expressing and purifying recombinant A. gossypii ERG9?

For optimal expression and purification of recombinant A. gossypii ERG9, the following protocol is recommended:

Expression System Selection:

  • Native A. gossypii expression systems using strong constitutive promoters like AgTEF and AgGPD have shown 8-fold higher expression levels than heterologous systems using promoters like ScPGK1 .

  • For heterologous expression, removal of terminator sequences with autonomous replicating activity (such as ScADH1 terminator) has been shown to improve expression by 2-fold .

Purification Protocol:

  • Express the full-length protein (amino acids 1-441)

  • Use affinity chromatography with appropriate tags (tag type to be determined during production process)

  • Store in Tris-based buffer with 50% glycerol at -20°C for standard storage or -80°C for extended storage

  • For working solutions, prepare aliquots to be stored at 4°C for up to one week to avoid freeze-thaw cycles

How can I assess ERG9 activity in metabolic engineering experiments?

Assessment of ERG9 activity in metabolic engineering contexts requires a multi-faceted approach:

Direct Enzyme Activity Measurement:

  • Spectrophotometric assays measuring the conversion of FPP to squalene

  • Radiometric assays using labeled precursors

Indirect Metabolic Analysis:

  • Monoterpene production levels as inverse indicators of ERG9 activity

  • Growth curve analysis, as shown in Figure 1

Table 1: Correlation between ERG9 modulation and monoterpene production

Genetic BackgroundCultivation ConditionsMonoterpene Yield (mg/L)Reference
F95W A. gossypii + NPP pathwayFlask culture with xyloseSabinene: 684.5
F95W A. gossypii + NPP pathwayFlask culture with mixed waste streamLimonene: 383
Unmodified A. gossypiiStandard conditionsMinimal monoterpene production

How can I engineer A. gossypii ERG9 to enhance specific monoterpene production?

Engineering A. gossypii ERG9 for enhanced monoterpene production requires a strategic approach targeting multiple aspects of the metabolic network:

ERG9 Downregulation Strategies:

  • Implement controlled promoter systems to reduce ERG9 expression

  • Use RNA interference or CRISPR-based repression techniques

  • Introduce mutations that reduce catalytic efficiency while maintaining essential sterol production

Precursor Redirection:

  • Co-overexpress endogenous HMG1 (HMG-CoA reductase) and ERG12 (mevalonate kinase) genes alongside heterologous terpene synthases, which has been demonstrated to significantly increase monoterpene yields from xylose-containing media

  • Introduce heterologous NPP synthase to create an orthogonal pathway that diverts flux from ERG9-mediated sterol synthesis

Substrate Selectivity Optimization:

  • Different terpene synthases show varying substrate selectivity for NPP or GPP precursors in A. gossypii

  • For sabinene production specifically, the sabinene synthase from Salvia pomifera has shown promising results

What is the impact of ERG9 mutations on the metabolic network of A. gossypii?

ERG9 mutations have cascading effects throughout the A. gossypii metabolic network:

Primary Effects:

  • Altered sterol composition in cell membranes

  • Redirected carbon flux through the isoprenoid pathway

  • Changed cellular growth characteristics

Secondary Metabolic Effects:

  • Enhanced monoterpene production capacity

  • Modified substrate consumption patterns

  • Altered expression of related pathway enzymes through regulatory feedback

Studies have observed that sabinene-producing strains (with modified ERG9 activity) demonstrate higher xylose consumption rates, extended exponential growth phases, and greater biomass generation compared to limonene-producing strains, indicating significant metabolic network reorganization .

What are common challenges in working with recombinant A. gossypii ERG9 and how can they be addressed?

Challenge 1: Low expression yields

  • Solution: Replace standard promoters (ScPGK1) with native A. gossypii promoters (AgTEF, AgGPD) which have demonstrated up to 8-fold improvement in recombinant protein expression

  • Solution: Optimize carbon source selection, as glycerol has shown 1.5-fold higher recombinant protein production compared to glucose in A. gossypii

Challenge 2: Protein instability

  • Solution: Store purified protein in optimized buffer containing 50% glycerol

  • Solution: Avoid repeated freeze-thaw cycles by preparing working aliquots

Challenge 3: Substrate competition

  • Solution: Implement the F95W mutation in A. gossypii strains to reduce FPP synthase activity and enhance monoterpene production

  • Solution: Use mixed carbon source formulations, such as corn-cob lignocellulosic hydrolysates combined with sugarcane or beet molasses, which have supported high monoterpene yields (684.5 mg/L sabinene)

How can I optimize culture conditions for maximal terpene production in A. gossypii strains with modified ERG9?

Optimization of culture conditions is critical for maximizing terpene production in engineered A. gossypii strains:

Carbon Source Selection:

  • Xylose has been demonstrated as an excellent carbon source for sabinene production in engineered A. gossypii strains

  • Mixed formulations of corn-cob lignocellulosic hydrolysates with sugarcane or beet molasses have achieved 383 mg/L limonene and 684.5 mg/L sabinene

Culture Duration:

  • Extended cultivation periods (up to 240 hours) have shown continued monoterpene accumulation

  • Monitoring biomass production and substrate consumption rates is essential for determining optimal harvest times

Media Composition:

  • MX2 media containing 0.5% glucose plus 2% xylose has been effective for sabinene production

  • Further optimization of media components and operation conditions will likely enhance recombinant protein production and monoterpene yields

What emerging applications might benefit from research on A. gossypii ERG9?

Research on A. gossypii ERG9 has implications for several emerging biotechnological applications:

Renewable Chemical Production:

  • The production of monoterpenes from waste streams represents a sustainable approach to valuable chemical synthesis

  • A. gossypii's ability to utilize xylose-rich feedstocks makes it particularly promising for waste valorization efforts

Novel Therapeutic Development:

  • Understanding sterol biosynthesis in fungi can inform antifungal drug development

  • Engineered strains with modified ERG9 could serve as platforms for producing terpenoid-based pharmaceuticals

Synthetic Biology Tools:

  • Insights into ERG9 regulation and function contribute to the expanding molecular toolbox for A. gossypii

  • The genome-scale metabolic model of A. gossypii provides opportunities for systems-level engineering of isoprenoid pathways

How might genome-scale metabolic modeling inform ERG9 engineering strategies?

Genome-scale metabolic modeling provides powerful insights for ERG9 engineering:

Flux Balance Analysis:

  • Predicting optimal genetic manipulations to maximize monoterpene production

  • Identifying potential metabolic bottlenecks in engineered strains

In Silico Strain Design:

  • Simulation of ERG9 modifications before experimental implementation

  • Optimization of carbon source utilization for specific terpene products

Regulatory Network Integration:

  • Understanding how ERG9 regulation interacts with global cellular responses

  • Predicting unintended consequences of ERG9 modifications

The recently available genome-scale metabolic model for A. gossypii represents a significant advancement that will facilitate exploration of this organism's full biotechnological potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.