Recombinant Ashbya gossypii Translocation protein SEC62 (SEC62)

Shipped with Ice Packs
In Stock

Description

Discovery and Structure

The SEC62 protein is essential for protein translocation across the ER membrane in yeast and mammals . Homologues of SEC61 have been cloned from Schizosaccharomyces pombe and Yarrowia lipolytica, revealing a high degree of functional conservation within this core component of the ER translocation machinery . S. pombe Sec61p shares 58.6% sequence identity with that of S. cerevisiae, while the Y. lipolytica protein shares 68.8% sequence identity with S. cerevisiae Sec61p .

Role in Protein Translocation

SEC62, along with SEC63, is involved in post-translational transport of presecretory proteins into the mammalian ER . The Sec62–Sec63 complex facilitates the translocation of the C-terminus of membrane proteins, suggesting its involvement in the topogenesis of membrane proteins in the ER .

Mutations in the N-terminal cytosolic domain of Sec62 can disrupt its interaction with Sec63, leading to defects in the translocation of moderately hydrophobic transmembrane (TM) segments of both single- and multi-spanning membrane proteins .

The Sec62–Sec63 complex is also involved in the membrane insertion of TM domains with charged flanking residues .

SEC62 in Cancer

The human SEC62 gene, located on chromosome 3q, has been identified as a tumor driver gene and is overexpressed in various tumors . High SEC62 expression levels have been associated with higher Gleason scores in prostate cancer, lymph node metastases and tumor cell de-differentiation in non-small cell lung cancer, and lymphatic metastases in head and neck squamous cell carcinoma . SEC62 may play a role in cancer metastasis .

SEC62 in Yeast

In yeast, Sec62 interacts with several other proteins, including Sec63, Sec71, and Sec72, to facilitate protein translocation into the ER . Sec62 assists in the translocation of proteins with a C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SEC62; ABR196C; Translocation protein SEC62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Target Names
Target Protein Sequence
MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRALNSDEYRAKSEREPEKY PPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSKDYPHLLLSTKATLDADEY YVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVVYYLSLGLLGLLAVFSALALV RFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLYGFGETECYGYIKKQKRRKRKLE KKKQ
Uniprot No.

Target Background

Function
Essential for preprotein translocation.
Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of SEC62 in Ashbya gossypii?

SEC62 in A. gossypii functions as an essential component of the translocation machinery responsible for moving secretory proteins across the endoplasmic reticulum (ER) membrane. The protein is particularly critical for post-translational translocation, where it recognizes and binds to signal peptides of nascent proteins destined for the secretory pathway . Unlike some other components of the translocation machinery, SEC62 is essential for cell survival in yeast systems, highlighting its fundamental role in protein processing and cellular viability .

How does SEC62 contribute to the protein translocation process?

SEC62 participates in the heptameric SEC complex, which comprises SEC61, SBH1, SSS1, SEC62, SEC63, SEC71, and SEC72 . Within this complex, SEC62 serves as the primary recognizer of signal peptides on nascent proteins targeted for post-translational translocation. The mechanism involves:

  • Initial recognition and binding of signal peptides by SEC62

  • Simultaneous binding of the signal sequence at SEC61 and SEC62

  • Involvement of SEC72 in signal sequence recognition

  • Utilization of KAR2 ATPase activity as the driving force for translocation, "pulling" the nascent protein into the ER through a "ratcheting mechanism"

This process differs from co-translational translocation, which relies on the signal recognition particle (SRP) pathway instead.

How does Ashbya gossypii SEC62 compare to homologs in other organisms?

A comparative analysis reveals both conservation and divergence among SEC62 homologs across fungal species:

OrganismEssentialityKey Functional DifferencesComplementation
A. gossypiiEssentialPrimarily involved in post-translational translocationNot tested
S. cerevisiaeEssentialPart of both heptameric SEC complex and tetrameric SEC62/SEC63 complexReference strain
S. pombeEssentialFailed to complement S. cerevisiae mutantNo
C. albicansEssentialFailed to complement S. cerevisiae mutantNo
MammalsEssentialCritical for small protein secretionNo

In mammals, SEC62-dependent translocation has evolved to specifically handle small proteins, showing functional specialization compared to fungal homologs . The failure of complementation between species highlights that cytosolic interactions are essential for SEC62 function, and these interactions show species-specific adaptations .

What model systems are used to study A. gossypii SEC62?

A. gossypii serves as an excellent model organism for studying SEC62 function due to:

  • Its filamentous growth pattern with multinucleated and multibranching hyphae

  • Extensive synteny with the Saccharomyces cerevisiae genome, facilitating comparative genomic approaches

  • Well-established laboratory cultivation methods and genetic manipulation techniques

  • Natural overproduction of riboflavin, providing a phenotypic marker for successful transformations

  • Ecological niche understanding - isolated from plant-feeding insects of the suborder Heteroptera

Researchers can isolate A. gossypii from insects feeding on oleander in Florida, the U.S. Virgin Islands, and North Carolina, or from common milkweed in North Carolina and Virginia .

How does the SEC62-SEC complex interaction influence translocation efficiency?

The efficiency of post-translational protein translocation in A. gossypii depends on the precise assembly and coordination of the heptameric SEC complex. Research indicates that:

  • The SEC complex functions as an integrated unit where SEC62 cooperates with SEC61 and SEC72 during signal sequence recognition

  • SEC62 and SEC63 are essential components, while SEC71 and SEC72 are dispensable but contribute to optimal efficiency

  • Mutations affecting SEC62's interaction with other complex members show varying degrees of translocation defects for different substrate proteins

This differential effect on substrates suggests that SEC62's role in the complex may be substrate-specific, with some proteins being more severely affected by SEC62 dysfunction than others .

What are potential experimental approaches for studying SEC62 function?

Advanced experimental approaches for studying SEC62 function include:

  • In vitro translocation assays: Using isolated membranes from wild-type and SEC62 mutant cells to measure translocation of specific substrates like alpha-factor precursor (ppαF)

  • Complementation studies: Testing whether SEC62 from different species can complement SEC62 mutants in S. cerevisiae

  • Protein interaction mapping: Identifying critical residues for interaction with other components of the translocation machinery

  • Conditional mutants: Generating temperature-sensitive mutations to study SEC62 function under restrictive conditions

  • Substrate profiling: Identifying which secretory proteins are most affected by SEC62 mutations

Research has shown that SEC62 mutations primarily affect certain substrates (like ppαF and preprocarboxypeptidase Y) while having less impact on others (like invertase) .

How does SEC62 contribute to A. gossypii's unique biological characteristics?

A. gossypii's distinctive characteristics, such as filamentous growth and riboflavin overproduction, may be influenced by SEC62 through:

  • Secretory pathway efficiency: Proper protein translocation is crucial for cell wall formation and hyphal extension

  • Polarized growth support: The secretory pathway, including SEC62, contributes to the highly polarized growth pattern of A. gossypii hyphae

  • Potential connection to filamentous growth: Similar to how the fimbrin SAC6 and Wiskott-Aldrich Syndrome Protein (WASP) homolog WAL1 affect polarized hyphal growth through actin organization and endocytosis

  • Possible role in riboflavin export: Given A. gossypii's natural overproduction of riboflavin, SEC62 may indirectly influence this process through its effects on the secretory pathway

Understanding SEC62's contribution to these characteristics requires further investigation, particularly in examining the secretory pathway's role in supporting filamentous growth.

How might SEC62 function relate to A. gossypii's ecological niche?

Recent isolation of A. gossypii from plant-feeding insects provides insight into potential ecological relevance of SEC62 function:

  • A. gossypii has been found in adults and juveniles (but not eggs) of large milkweed bugs feeding on oleander and common milkweed

  • The characteristic yellow pigmentation due to riboflavin overproduction may serve as an ecological signal or protective mechanism

  • SEC62's role in protein secretion could be important for fungal-insect interactions, potentially including:

    • Secretion of enzymes for nutrient acquisition within the insect host

    • Production of compounds that facilitate colonization

    • Adaptation to varying environmental conditions encountered in the insect host

This ecological context provides a framework for understanding the selective pressures that may have shaped SEC62 function in A. gossypii.

What are optimal approaches for expressing recombinant A. gossypii SEC62?

For successful expression and purification of recombinant A. gossypii SEC62:

  • Expression system selection: Consider using:

    • E. coli systems for non-glycosylated protein production

    • Yeast expression systems (S. cerevisiae or P. pastoris) for proper folding and post-translational modifications

    • Insect cell systems for membrane protein expression

  • Construct design considerations:

    • Include appropriate affinity tags (His, GST, or MBP) for purification

    • Consider expressing hydrophilic domains separately if full-length protein expression is challenging

    • Use codon optimization based on the expression host

  • Solubilization strategies:

    • As SEC62 is a membrane protein with two transmembrane domains, appropriate detergents must be selected

    • Consider non-ionic detergents like DDM or LDAO for initial extraction

    • Evaluate detergent screening to identify optimal conditions for protein stability

  • Purification approach:

    • Utilize affinity chromatography as the initial capture step

    • Follow with size exclusion chromatography to ensure homogeneity

    • Consider ion exchange chromatography as an additional purification step

What methods can detect protein translocation defects in SEC62 studies?

Several established assays can evaluate protein translocation defects in SEC62 mutants:

  • In vitro translocation assays:

    • Cell-free systems using isolated ER membranes

    • Radiolabeled precursor proteins like ppαF

    • Detection of signal sequence cleavage as evidence of successful translocation

  • In vivo analyses:

    • Monitoring accumulation of untranslocated precursors

    • Glycosylation status of secretory proteins

    • Secretion efficiency of reporter proteins

  • Microscopy-based approaches:

    • Immunofluorescence to detect mislocalized secretory proteins

    • Live-cell imaging of fluorescently tagged secretory proteins

    • Transmission electron microscopy to observe ER structural abnormalities

These methodologies can be adapted from established S. cerevisiae protocols, with appropriate modifications for A. gossypii's filamentous growth pattern.

How can researchers generate and analyze SEC62 mutations in A. gossypii?

For comprehensive functional analysis of SEC62 through mutagenesis:

  • Mutation strategy selection:

    • Site-directed mutagenesis for targeting specific functional domains

    • Random mutagenesis for unbiased functional screens

    • Domain swapping with SEC62 from other species to identify species-specific functional elements

  • Transformation approaches:

    • A. gossypii-specific transformation protocols utilizing homologous recombination

    • Consideration of essential gene status - use of conditional promoters or heterozygous strains

  • Phenotypic analysis:

    • Growth rate determination at different temperatures

    • Hyphal morphology and branching pattern assessment

    • Protein secretion profiling

    • ER stress response evaluation

  • Complementation testing:

    • Testing ability of mutant constructs to complement SEC62 deletion

    • Heterologous complementation in S. cerevisiae SEC62 mutants

When designing mutations, researchers should consider the two transmembrane domains and the potential α-helical domain with positively charged residues that may be involved in protein interactions .

What techniques are available for studying SEC62 interactions with other proteins?

Several approaches can identify and characterize SEC62 interaction partners:

  • Co-immunoprecipitation:

    • Using antibodies against tagged SEC62 to isolate protein complexes

    • Mass spectrometry analysis of co-precipitated proteins

  • Crosslinking approaches:

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Site-specific crosslinkers to map interaction interfaces

  • Yeast two-hybrid screening:

    • Using SEC62 domains as bait to identify potential interactors

    • Confirmation with targeted Y2H for specific protein pairs

  • Proximity labeling:

    • BioID or APEX2 fusions to SEC62 for in vivo labeling of proximal proteins

    • Particularly useful for transient or weak interactions

  • Structural studies:

    • Cryo-EM of the assembled SEC complex

    • X-ray crystallography of SEC62 with interaction partners

These approaches can elucidate how SEC62 integrates into the larger translocation machinery and identify potentially novel interaction partners.

What are emerging areas of SEC62 research in A. gossypii?

Several promising research directions may advance understanding of A. gossypii SEC62:

  • Comparative genomics approaches: Further analysis of SEC62 evolution across fungi with different growth morphologies to correlate sequence changes with functional adaptations

  • Systems biology integration: Examining how SEC62 function coordinates with other cellular processes in the context of A. gossypii's unique biology

  • Ecological relevance studies: Investigating the role of SEC62-dependent secretion in fungal-insect interactions and environmental adaptation

  • Structural biology advances: Determining the high-resolution structure of A. gossypii SEC62 to understand species-specific functional adaptations

  • Biotechnological applications: Exploring how manipulating SEC62 might enhance A. gossypii's utility for riboflavin production or heterologous protein expression

These directions promise to deepen our understanding of this essential component of the protein translocation machinery in an organism with significant biological and biotechnological relevance.

How might SEC62 research contribute to broader scientific understanding?

Research on A. gossypii SEC62 has potential impacts beyond this specific protein:

  • Evolutionary insights: Understanding how protein translocation mechanisms have adapted to support different fungal growth morphologies

  • Fundamental cellular biology: Elucidating the relationship between secretory pathway function and polarized growth

  • Biotechnology applications: Improving heterologous protein secretion systems based on understanding SEC62 function

  • Medical relevance: Providing comparative insights for human SEC62, which has been implicated as a potential biomarker and therapeutic target for various tumors

By investigating this protein in a filamentous fungus with unique characteristics, researchers can gain insights that complement work in traditional model organisms like S. cerevisiae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.