Recombinant Aspergillus clavatus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

What is the AIM31 protein in Aspergillus clavatus?

The AIM31 protein (also known as Respiratory supercomplex factor 1, mitochondrial) in Aspergillus clavatus is a 178-amino acid mitochondrial protein involved in the inheritance and function of mitochondria. It belongs to the Altered Inheritance of Mitochondria (AIM) family of proteins, which are critical for proper mitochondrial maintenance and distribution during cell division. The full-length protein contains a mitochondrial localization sequence and is encoded by the rcf1 gene (synonyms: aim31, ACLA_047490) . The protein has a specific amino acid sequence: MDQEPIPSSLEDNPQFKEETSLQKFRRRFKEEPLIPLGCAATSYALYRAYRSMKAGDSVE MNKMFRARIYAQFFTLIAVVAGGMYFKTERQQRREFEKMVEQRKAQEKRDAWLRELEVRD KEDKDWRERHAAMEAAAKEAGKRKSVPEQDAARSAIEPADEKSIGVLAAVRELLARQN .

How does AIM31 function in mitochondrial respiratory complexes?

AIM31 functions as a respiratory supercomplex factor that helps maintain the structural integrity and assembly of mitochondrial respiratory chain supercomplexes. The protein likely facilitates interactions between components of the electron transport chain, particularly between complexes III and IV. Methodologically, this can be studied using blue native gel electrophoresis to analyze intact respiratory complexes isolated from wild-type versus AIM31-depleted mitochondria. Additionally, oxygen consumption measurements using respirometry can reveal functional defects in electron transport when AIM31 is absent or mutated.

What organism-specific characteristics should researchers consider when working with A. clavatus AIM31?

When working with Aspergillus clavatus AIM31, researchers should consider that A. clavatus is a pathogenic fungus commonly found in soil and animal manure . It produces mycotoxins, including patulin, which can potentially contaminate laboratory cultures. The organism grows optimally at approximately 25°C (77°F), with growth limits between 5°C and 42°C (41-107°F) . A. clavatus has a distinctive morphology, forming a velvety felt that is greenish-blue in color with whitish margins . These characteristics may influence culture conditions, safety protocols, and experimental design when working with native versus recombinant AIM31.

What expression systems are most effective for recombinant A. clavatus AIM31 production?

The most effective expression system documented for recombinant A. clavatus AIM31 production is E. coli . The protein can be successfully expressed with an N-terminal His-tag to facilitate purification . Alternative expression systems including yeast, baculovirus, and mammalian cells are also viable options as evidenced by similar approaches with homologous proteins . For optimal expression in E. coli, researchers should consider codon optimization of the A. clavatus sequence, as fungal codon usage may differ significantly from bacterial preferences. Expression in eukaryotic systems may provide advantages for proper folding of this mitochondrial protein, though at potentially lower yields than bacterial systems.

What purification protocol yields the highest purity for functional studies of AIM31?

For high-purity AIM31 suitable for functional studies, a multi-step purification protocol is recommended. Initially, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin can capture the His-tagged protein. According to available product specifications, this approach can yield protein with greater than 90% purity as determined by SDS-PAGE . For functional studies requiring exceptional purity, additional purification steps such as ion-exchange chromatography followed by size-exclusion chromatography are recommended. The final purified protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Batch-to-batch consistency should be verified using analytical techniques such as mass spectrometry and circular dichroism to ensure proper folding.

How should researchers optimize reconstitution of lyophilized AIM31 for experimental applications?

Optimal reconstitution of lyophilized AIM31 protein requires careful attention to several parameters. First, the vial containing lyophilized protein should be briefly centrifuged to ensure all material is at the bottom . The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the standard concentration used in commercial preparations . After reconstitution, the solution should be gently mixed rather than vortexed to prevent protein denaturation. Aliquoting the reconstituted protein for single-use applications will minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended and can lead to protein degradation and loss of activity .

What techniques are most informative for analyzing AIM31 structure-function relationships?

For analyzing structure-function relationships of AIM31, a combination of structural and functional techniques provides the most comprehensive insights. X-ray crystallography or cryo-electron microscopy can determine the three-dimensional structure of purified AIM31. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is valuable for mapping conformational changes and identifying interaction surfaces. Functionally, site-directed mutagenesis of conserved residues followed by respirometry, blue native PAGE analysis of respiratory complexes, and mitochondrial inheritance assays in model systems can correlate structural features with specific functions. The amino acid sequence provided (178 residues) contains regions likely important for membrane association and protein-protein interactions that can be targeted for mutational analysis .

How can researchers effectively measure AIM31 interactions with respiratory complex components?

Researchers can effectively measure AIM31 interactions with respiratory complex components using multiple complementary approaches. Co-immunoprecipitation using antibodies against AIM31 or respiratory complex components can identify physical interactions in native or recombinant systems. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides quantitative binding parameters using purified components. Proximity-based techniques such as crosslinking mass spectrometry or FRET (Förster Resonance Energy Transfer) can map interaction interfaces with high spatial resolution. For in situ analysis, split-GFP complementation or proximity ligation assays can visualize interactions within intact mitochondria. When designing these experiments, researchers should consider the hydrophobic nature of many respiratory complex components and optimize detergent conditions accordingly.

How conserved is AIM31 across fungal species, and what implications does this have for research?

AIM31 shows considerable conservation across diverse fungal species including Aspergillus species, Saccharomyces cerevisiae, Candida species, and Paracoccidioides brasiliensis . This conservation suggests fundamental roles in mitochondrial function across the fungal kingdom. Research implications of this conservation include:

The conservation pattern enables comparative genomics approaches to identify critical functional domains and residues under evolutionary pressure. Using heterologous expression systems, researchers can perform cross-species complementation studies to determine functional conservation experimentally.

What experimental approaches best demonstrate functional conservation or divergence between A. clavatus AIM31 and homologs?

To demonstrate functional conservation or divergence between A. clavatus AIM31 and homologs from other species, researchers should employ complementation studies in knockout models. This involves expressing the A. clavatus AIM31 in systems (such as S. cerevisiae) where the endogenous homolog has been deleted, then assessing restoration of phenotypes including mitochondrial morphology, respiratory function, and inheritance patterns. Chimeric proteins containing domains from different species can pinpoint regions responsible for species-specific functions. Reciprocal yeast two-hybrid or co-immunoprecipitation studies can identify whether interaction partners are conserved across species. Additionally, comparative structural analyses through homology modeling based on the amino acid sequences available from different species can highlight structural differences that may explain functional divergence .

How can AIM31 research contribute to understanding fungal pathogenicity mechanisms?

AIM31 research can contribute significantly to understanding fungal pathogenicity mechanisms through several avenues. As A. clavatus is a pathogenic fungus capable of producing mycotoxins and causing hypersensitivity pneumonitis , investigating how mitochondrial function through AIM31 affects virulence factor production could reveal novel pathogenicity mechanisms. Methodologically, researchers can create AIM31 knockout or knockdown strains and assess changes in mycotoxin production, particularly patulin. Since mitochondrial function is critical during host-pathogen interactions, examining how AIM31 contributes to stress resistance during infection models may identify potential drug targets. Comparative studies between pathogenic (A. clavatus, A. flavus) and non-pathogenic fungal species could reveal whether AIM31 sequence variations correlate with pathogenicity .

What role does AIM31 play in cellular responses to hypoxic conditions in fungi?

AIM31 likely plays a crucial role in fungal responses to hypoxic conditions, as suggested by its annotation as a "mitochondrial hypoxia responsive domain protein" in some species . Methodologically, researchers should investigate AIM31 expression and protein levels under normoxic versus hypoxic conditions using qRT-PCR and western blot analysis. Chromatin immunoprecipitation (ChIP) assays can determine whether hypoxia-responsive transcription factors bind to the AIM31 promoter. Functionally, respirometry measurements comparing oxygen consumption and reactive oxygen species production in wild-type versus AIM31-deficient strains under various oxygen tensions would reveal its role in adapting electron transport to low oxygen. Since A. clavatus grows in diverse environments including decomposing materials where oxygen gradients exist , AIM31 may be particularly important for environmental adaptation in this species.

How can site-directed mutagenesis of AIM31 reveal critical functional domains?

Site-directed mutagenesis of AIM31 can systematically reveal critical functional domains through targeted alterations of the 178-amino acid sequence . Based on the available sequence data, researchers should focus on:

Each mutant should be expressed in systems lacking endogenous AIM31, followed by comprehensive functional analysis including respiratory complex assembly (blue native PAGE), mitochondrial membrane potential (fluorescent dyes), and protein-protein interaction assays (co-IP, crosslinking). This systematic approach will create a functional map of the protein that correlates sequence with specific aspects of AIM31 function.

How can researchers overcome solubility issues with recombinant AIM31?

Researchers can overcome solubility issues with recombinant AIM31 through multiple optimization strategies. As a mitochondrial protein likely containing hydrophobic regions, AIM31 may aggregate during expression and purification. To address this, fusion partners such as MBP (maltose-binding protein) or SUMO can enhance solubility beyond the standard His-tag . Expression temperature optimization is critical—lowering to 16-18°C may improve folding. For purification, screening different detergents (mild non-ionic detergents like DDM or Triton X-100) can maintain solubility of membrane-associated regions. The buffer composition should be optimized; the documented Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides a starting point . For reconstitution, a concentration range of 0.1-1.0 mg/mL is recommended to prevent aggregation . If inclusion bodies form despite these measures, optimized denaturation-refolding protocols using urea or guanidine hydrochloride gradient dialysis can recover functional protein.

What are common pitfalls in AIM31 functional assays and how can they be addressed?

Common pitfalls in AIM31 functional assays include protein instability, non-specific interactions, and difficulties in measuring mitochondrial-specific effects. To address these challenges, researchers should first ensure protein quality through analytical size exclusion chromatography and dynamic light scattering to confirm monodispersity before functional studies. For interaction studies, appropriate controls including non-relevant His-tagged proteins should rule out tag-mediated artifacts. Since repeated freeze-thaw cycles significantly impact protein quality, aliquoting reconstituted AIM31 and storing at -80°C with 50% glycerol is essential . When performing cellular assays, mitochondrial-targeted controls should distinguish AIM31-specific effects from general mitochondrial perturbations. Given AIM31's potential role in respiratory complex assembly, control experiments should account for indirect effects on mitochondrial function that might not represent primary AIM31 activities.

How should researchers interpret conflicting data regarding AIM31 function across different experimental systems?

When interpreting conflicting data regarding AIM31 function across experimental systems, researchers should systematically analyze several factors. First, expression system differences must be considered—AIM31 expressed in E. coli (lacking mitochondria) versus eukaryotic systems may show functional variations due to post-translational modifications or folding differences . Second, tag influence should be evaluated, as the position and nature of affinity tags (e.g., N-terminal His-tag vs. C-terminal tags) may differentially affect function . Third, species-specific effects should be analyzed by comparing results across homologs from different organisms . Quantitative methods such as isothermal titration calorimetry can provide binding constants that help resolve discrepancies in interaction studies. When publishing, researchers should explicitly report all experimental conditions, including expression systems, buffer compositions, and assay temperatures, to facilitate cross-laboratory comparison and reproducibility evaluation.

What statistical approaches are most appropriate for analyzing AIM31 interaction data?

For analyzing AIM31 interaction data, appropriate statistical approaches depend on the experimental methodology. For physical binding assays like surface plasmon resonance or isothermal titration calorimetry, nonlinear regression analysis to derive binding constants (KD values) with 95% confidence intervals provides quantitative comparison between different interaction partners. For co-immunoprecipitation studies, densitometric analysis with normalization to input controls, analyzed by t-tests or ANOVA with appropriate multiple testing correction, can determine significant differences in binding affinities. When analyzing respiratory complex assembly in the presence or absence of AIM31, hierarchical clustering of complex composition data can identify patterns of dependency. For high-throughput interaction screens, false discovery rate (FDR) control methods such as Benjamini-Hochberg procedure should be applied to manage multiple hypothesis testing. All interaction experiments should include biological replicates (n≥3) to ensure statistical robustness.

What emerging technologies will advance AIM31 research in the next five years?

Emerging technologies poised to advance AIM31 research include cryo-electron tomography for visualizing AIM31 within native mitochondrial membrane environments at near-atomic resolution. AlphaFold2 and similar AI-based structural prediction tools will provide increasingly accurate structural models of AIM31 and its complexes, guiding rational experimental design. CRISPR-based technologies for fungal genome editing will enable more precise in vivo studies of AIM31 function with minimal off-target effects. Single-molecule tracking microscopy will reveal the dynamics of AIM31 within living mitochondria. Proximity-dependent biotin identification (BioID) or APEX2 techniques will map the complete protein interaction neighborhood of AIM31 in native mitochondria. Integration of multi-omics approaches (proteomics, metabolomics, transcriptomics) will provide systems-level understanding of AIM31's role in mitochondrial function across different conditions and species.

How might research on fungal AIM31 translate to understanding mitochondrial diseases in humans?

Research on fungal AIM31 may provide valuable insights for understanding human mitochondrial diseases through evolutionary conservation of mitochondrial protein complexes. While direct human orthologs may not be immediately apparent, the mechanisms of respiratory supercomplex assembly and mitochondrial inheritance that involve AIM31 in fungi likely have functional counterparts in human cells. Methodologically, researchers can identify human proteins with similar functions through complementation studies in fungal models, testing whether human candidates rescue AIM31 deletion phenotypes. Comparative analysis of respiratory complex assembly between fungi and human cells may reveal conserved principles disrupted in mitochondrial disorders. Drug screening using AIM31-deficient fungi could identify compounds that rescue respiratory defects, potentially leading to therapeutic approaches for human mitochondrial diseases with similar biochemical profiles. This translational approach requires careful consideration of the evolutionary distance between fungi and humans while focusing on conserved mitochondrial functions.