Recombinant Aspergillus clavatus Chitin synthase export chaperone (chs7)

Shipped with Ice Packs
In Stock

Description

Functional Significance

Chs7 ensures proper folding and ER export of Chs3, enabling chitin deposition in fungal cell walls. Key findings include:

  • Cell Wall Integrity: Required for hyphal morphogenesis, mating tube formation, and stress resistance in Aspergillus species .

  • Pathogenesis: In Magnaporthe oryzae, Chs7 deletion reduces appressorial chitin content by ~63%, impairing plant infection .

  • Chaperone Mechanism: Chs7 stabilizes Chs3 during ER transit and regulates its enzymatic activity post-export .

Comparative Analysis Across Species

OrganismChs7 FunctionChs3 Interaction
A. clavatusER export of Chs3; cell wall biogenesisDirect binding
Kluyveromyces lactisChs3 trafficking to bud neckEssential for activity
Saccharomyces cerevisiaeER retention of Chs3 aggregates if absentStability-dependent

Applications and Implications

  • Antifungal Targets: Chs7 is a potential target for fungicides, as disrupting Chs3 export weakens fungal cell walls .

  • Biotechnological Use: Recombinant Chs7 aids in studying chitin synthase regulation and fungal pathogenicity mechanisms .

Current Challenges and Future Directions

  • Mechanistic Details: How Chs7 precisely regulates Chs3 activity post-export remains unclear .

  • Species-Specific Roles: Functional divergence exists between Chs7 homologs in pathogenic vs. non-pathogenic fungi .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
chs7; ACLA_023530; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
chs7
Target Protein Sequence
MGFGDFDSICAKTALPLCSLVGPSSSSISGSTGIISNCYARNVELANTIIFEGAASFVHI IALAMTVIMILHVRSKFTAVGRKEIITFFYIYMALTICSLVIDAGVVPPRSGPFPYFVAA QNGLASALCTCLLVNGFVGFQLYEDGTFLSVWLLRLTSAVMFVVSFLISILTFKSWGGMS PTNTIGLFVVLYILNALCIAIYLVMQLLLVMNTLEDRWPLGHIAFGVIVFICGQVLLYAF SDTICDNVQHYLDGLFFATFCNLLAVMMVYKFWDYITKEDLEFSVGIKPNTWEVKELLPE EDRRTTAYQDSHSEYAGSMYHHRASTYGNQNY
Uniprot No.

Target Background

Function
This chaperone is essential for the export of chitin synthase chs3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Chs7 and what is its role in fungal cell wall biosynthesis?

Chs7 is a dedicated membrane-localized chaperone protein essential for the proper functioning of chitin synthase enzymes (particularly Chs3) in fungi. It plays a dual role in chitin synthase function: first promoting proper folding and endoplasmic reticulum (ER) exit of chitin synthase, and subsequently regulating its enzymatic activity at the plasma membrane . In the absence of Chs7, chitin synthase forms high molecular weight aggregates and becomes retained in the ER, preventing its transit to the cell surface where it functions in cell wall chitin synthesis . This ultimately impairs fungal cell wall formation, as chitin is a critical structural component that provides rigidity and protection to fungal cells.

What experimental evidence confirms the interaction between Chs7 and chitin synthases?

Research primarily from studies in Saccharomyces cerevisiae has demonstrated that Chs7 forms a stable complex with Chs3 (chitin synthase III) throughout the secretory pathway . Experimental evidence includes co-immunoprecipitation studies, subcellular co-localization, and functional assays demonstrating the dependence of Chs3 transport on Chs7 presence. Additionally, genetic studies have shown that mutations in the Chs7 C-terminal cytosolic domain disrupt its association with Chs3 at post-ER transport steps, while still allowing initial chaperoning function in the ER . This confirms that Chs7 engages in functionally distinct interactions with Chs3 at different stages of the secretory pathway.

What are the optimal conditions for expression and purification of recombinant Chs7?

Based on established protocols, recombinant Aspergillus clavatus Chs7 can be efficiently expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The optimal expression and purification methodology includes:

ParameterRecommended Condition
Expression SystemE. coli
TagN-terminal His tag
Purification MethodNickel affinity chromatography
Buffer CompositionTris/PBS-based buffer, pH 8.0
Stabilizer6% Trehalose
Final Concentration0.1-1.0 mg/mL
StorageAliquot with 50% glycerol at -20°C/-80°C
Quality Control>90% purity by SDS-PAGE

For reconstitution of lyophilized protein, it's crucial to briefly centrifuge the vial before opening and reconstitute in deionized sterile water. Addition of 5-50% glycerol (with 50% being standard) is recommended for long-term storage to prevent freeze-thaw damage .

How can Chs7-Chs3 interactions be studied in vitro and in vivo?

Several complementary approaches can be employed to investigate Chs7-Chs3 interactions:

In vivo approaches:

  • Co-localization studies using fluorescently tagged proteins (e.g., GFP-Chs7 and RFP-Chs3) to track their movement through the secretory pathway

  • Bimolecular fluorescence complementation (BiFC) to visualize direct protein-protein interactions

  • Co-immunoprecipitation using epitope-tagged proteins to isolate native complexes

  • Genetic studies with domain-specific mutations to identify interaction regions

  • Phenotypic analysis of chs7 deletion or mutation strains to assess functional consequences

In vitro approaches:

  • Pull-down assays using recombinant proteins with affinity tags

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic characterization

  • Crosslinking mass spectrometry to identify interacting domains

  • Reconstitution of Chs7-Chs3 complexes in artificial membrane systems

Experimental evidence has shown that mutations in the Chs7 C-terminal cytosolic domain disrupt its continued association with Chs3 at post-ER transport steps, suggesting this domain is critical for maintained interaction throughout the secretory pathway .

What experimental design approaches are most suitable for studying Chs7 function?

The randomized complete block design (RBD) is particularly suitable for studying Chs7 function across different experimental conditions, as it allows for control of variation from multiple factors that might influence experimental outcomes . This design is especially valuable when:

  • Testing Chs7 function across different fungal species or strains

  • Evaluating effects of multiple mutations on Chs7 activity

  • Assessing Chs7 performance under various stress conditions

In an RBD setup for Chs7 functional studies:

  • Blocks represent experimental batches or conditions that might introduce variability

  • Treatments represent different Chs7 variants, concentrations, or experimental interventions

  • Each treatment appears once in each block to control for block-specific variation

Analysis of Variance (ANOVA) can then be employed to separate the effects due to treatments (e.g., Chs7 mutations) from those due to blocks (e.g., experimental batches) . This approach increases statistical power by reducing unexplained variation.

How do mutations in the C-terminal domain of Chs7 affect its chaperone function?

Research has identified specific mutations in the Chs7 C-terminal cytosolic domain that produce a separation-of-function phenotype, differentially affecting its dual roles in chitin synthase processing . Key findings include:

These findings reveal that Chs7 has functionally distinct interactions with Chs3: first as a traditional chaperone promoting folding and ER exit, and subsequently as a regulator of enzymatic activity at the plasma membrane . The C-terminal domain appears specifically involved in this second regulatory function.

What factors influence Chs7 trafficking from ER to plasma membrane?

The trafficking of Chs7 from the ER to plasma membrane involves several molecular mechanisms and regulatory factors:

Trafficking FactorRole in Chs7 Transport
COPII vesiclesMediate ER export of Chs7-Chs3 complexes
Exomer complexFacilitates transport from Golgi to plasma membrane
Arf1 GTPaseRegulates vesicle formation and cargo selection
Actin cytoskeletonProvides tracks for vesicle transport
Endocytic recyclingControls Chs7-Chs3 complex internalization and redistribution

Research has demonstrated that Chs7 itself exits the ER and localizes with Chs3 at the bud neck and intracellular compartments . This indicates that, contrary to earlier characterizations as simply an ER-resident protein, Chs7 accompanies Chs3 throughout the secretory pathway. This continued association appears important for maintaining optimal chitin synthase activity at the cell surface, though not essential for trafficking itself.

How can contradictory data regarding Chs7 localization be resolved?

Resolving contradictory findings regarding Chs7 localization requires careful experimental design and multiple complementary approaches:

  • Time-resolved imaging: Track Chs7 localization over time using live-cell imaging with photoactivatable fluorescent proteins to distinguish static vs. dynamic populations

  • Subcellular fractionation with quantitative analysis: Perform rigorous biochemical fractionation with markers for different cellular compartments, quantifying the proportion of Chs7 in each fraction

  • Super-resolution microscopy: Employ techniques like STORM or PALM to resolve Chs7 localization beyond the diffraction limit

  • Correlative light and electron microscopy (CLEM): Combine fluorescence microscopy with electron microscopy to precisely localize Chs7 in the context of cellular ultrastructure

  • Controlled expression systems: Use inducible promoters to distinguish newly synthesized from steady-state Chs7 populations

The apparent contradiction between earlier characterizations of Chs7 as an ER-resident protein and newer findings showing its presence at the plasma membrane can be explained by its dynamic trafficking pattern and the limitations of earlier detection methods .

What methodological approaches can distinguish the dual roles of Chs7?

Distinguishing between Chs7's chaperone function in the ER and its regulatory role at the plasma membrane requires sophisticated experimental approaches:

  • Domain-specific mutations: Create targeted mutations in different Chs7 domains and assess their differential effects on folding vs. enzymatic regulation

  • Temporally controlled rescue experiments: Use rapid induction systems to express Chs7 at different stages of Chs3 trafficking to determine when its presence is critical

  • In vitro reconstitution: Develop membrane-based assays that separately test Chs7's abilities to promote folding and to enhance enzymatic activity

  • Split-protein complementation: Engineer Chs7 variants where different domains can be independently induced or inhibited to parse their functions

  • Structure-function analysis: Solve the structure of Chs7-Chs3 complexes at different trafficking stages to identify conformational changes associated with each function

Research has already employed point mutations that specifically disrupt the post-ER association of Chs7 with Chs3 while preserving its chaperone function, demonstrating the feasibility of experimentally separating these functions .

How can structural studies of membrane-associated Chs7 be optimized?

Structural characterization of membrane proteins like Chs7 presents significant technical challenges. Optimization strategies include:

ChallengeOptimization Approach
Protein extractionUse mild detergents (DDM, LMNG) or nanodiscs to maintain native conformation
Protein stabilityIncorporate stabilizing mutations or fusion partners to enhance conformational stability
Crystal formationEmploy lipidic cubic phase (LCP) crystallization for membrane proteins
Data collectionUse microfocus beamlines for small or imperfect crystals
Alternative methodsApply cryo-EM for structure determination without crystallization
Computational approachesEmploy molecular dynamics simulations to model membrane embedding

Additionally, the use of recombinant expression systems with optimized tags (like the His-tag used for Aspergillus clavatus Chs7 ) can facilitate purification while minimizing interference with protein structure. For functional studies, reconstitution into artificial membrane systems like proteoliposomes or nanodiscs can provide a native-like environment while enabling controlled experimental manipulation.

How can recombinant Chs7 be used to study fungal cell wall assembly mechanisms?

Recombinant Chs7 proteins, such as the His-tagged Aspergillus clavatus Chs7 , provide powerful tools for investigating fungal cell wall assembly:

  • Reconstitution studies: Purified Chs7 can be combined with Chs3 in artificial membrane systems to reconstitute chitin synthesis in vitro, allowing detailed biochemical characterization

  • Structure-guided mutagenesis: The availability of recombinant protein facilitates systematic mutation of specific domains to map functional regions

  • Interaction screening: Immobilized Chs7 can be used to identify novel protein interactions in the cell wall synthesis pathway

  • Inhibitor development: The recombinant protein enables high-throughput screening of potential inhibitors targeting the Chs7-Chs3 interaction

  • Cross-species complementation: Recombinant Chs7 from different fungal species can be tested for functional complementation to understand evolutionary conservation of mechanisms

In experimental applications, the full-length recombinant Chs7 (1-332 amino acids) with N-terminal His tag, expressed in E. coli and purified to >90% purity, provides a consistent and well-characterized reagent for such studies .

What methodological strategies can address challenges in Chs7 functional assays?

Several methodological strategies can overcome challenges in assessing Chs7 function:

  • Development of cell-free chitin synthesis assays: Create defined systems with purified components to directly measure Chs7's effect on Chs3 activity

  • Compartment-specific inhibition: Use spatially restricted inhibitors or optogenetic approaches to selectively disrupt Chs7 function in specific cellular locations

  • Quantitative microscopy: Implement ratiometric imaging techniques to precisely measure Chs7-Chs3 co-localization across cellular compartments

  • Single-molecule tracking: Apply super-resolution microscopy with single-particle tracking to follow individual Chs7-Chs3 complexes through the secretory pathway

  • Biosensors for conformational changes: Develop FRET-based sensors that report on Chs7-induced conformational changes in Chs3

When designing experiments, a randomized complete block design is particularly effective for controlling experimental variation that might obscure Chs7's effects . This approach groups experimental units into homogeneous blocks to minimize within-block variability, allowing more precise measurement of treatment effects.

How can comparative studies of Chs7 across fungal species inform evolutionary understanding?

Comparative analysis of Chs7 across fungal species provides insights into the evolution of cell wall biosynthesis mechanisms:

  • Sequence conservation analysis: Compare Chs7 sequences across diverse fungi to identify conserved domains that likely perform core functions

  • Heterologous complementation: Test whether Chs7 from one species can functionally replace Chs7 in another species

  • Domain swapping experiments: Create chimeric Chs7 proteins with domains from different species to map species-specific functional regions

  • Correlation with cell wall composition: Analyze how Chs7 sequence variations correlate with differences in fungal cell wall architecture

  • Co-evolution analysis: Examine coordinated evolutionary changes between Chs7 and its partner proteins like Chs3

The availability of recombinant proteins like Aspergillus clavatus Chs7 facilitates these comparative approaches by providing standardized reagents for cross-species functional testing. Additionally, implementing a randomized complete block design for such comparative experiments helps control for experimental variation when testing proteins from different species under identical conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.