Recombinant Aspergillus clavatus Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Aspergillus clavatus Formation of crista junctions protein 1 (Fcj1), also known as Mitofilin (UniProt ID: A1CHB5), is a mitochondrial inner membrane protein critical for maintaining crista junction (CJ) architecture. In yeast and mammals, Fcj1 orthologs are enriched at CJs, which are tubular invaginations connecting the inner mitochondrial membrane to cristae. These structures are essential for mitochondrial organization, ATP synthesis, and cellular energy dynamics .

Domain Architecture

Fcj1 contains a conserved C-terminal domain (aa 42–628) critical for:

  • Oligomer formation: Self-interaction via the C-terminal domain stabilizes Fcj1 in multimeric complexes .

  • Outer membrane interaction: Binds Tob55 (a component of the TOB/SAM complex), anchoring CJs to the mitochondrial outer membrane .

  • Antagonistic regulation: Opposes the oligomerization of F₁F₀-ATP synthase subunits e and g, modulating cristae curvature and CJ formation .

FeatureDetailsSource
Functional DomainsC-terminal domain (essential for oligomerization and TOB/SAM interaction)
Genetic InteractionsAntagonizes F₁F₀ subunits e and g; suppresses growth defects in Δfcj1
Mitochondrial RoleMaintains CJ stability, cristae branching, and F₁F₀ supercomplex regulation

Key Discoveries

  1. CJ Formation and Cristae Morphology

    • Δfcj1 strains lack CJs, exhibit stacked cristae, and accumulate F₁F₀ supercomplexes .

    • Overexpression increases CJ number, enlarges CJ diameter, and reduces F₁F₀ oligomers .

  2. C-Terminal Domain Functions

    • Deletion of the C-terminal domain disrupts CJ formation and TOB/SAM complex interaction .

    • Genetic suppression of Δfcj1 growth defects occurs when F₁F₀ subunits e or g are deleted .

  3. Interaction Networks

    • TOB/SAM complex: Fcj1 binds Tob55, stabilizing CJs near the outer membrane .

    • MICOS complex: Part of a multisubunit complex regulating cristae architecture .

Experimental Uses

ApplicationDetailsSource
Structural StudiesAnalyzing CJ dynamics and Fcj1-TOB/SAM interactions in mitochondrial models
Disease ModelingExploring mitochondrial dysfunction in neurodegenerative disorders
Antifungal Drug DevelopmentStudying resistance mechanisms (e.g., Candida CYP51 interactions)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mic60; ACLA_047390; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-628
Protein Length
Full Length of Mature Protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
mic60
Target Protein Sequence
ADVKPPVVPGAPTPASPSSDTPIPPETVPKSTLADEATLPPPPPPPPAPVRKTGRFRRFL IYLILTSGFAYGGGIFLAMKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNANR APKDEGNKVTIPSKSGLSWKVAEEESGADLSAKGPHMSAVEQKGDEAQIKPGTAKPEEKV AAVEKAKSDKPVKEEAPKDTTKVQEEPRKPAVPAVTPIEFATVNEGDEAVVQELVKTFND IITVIGADESAHKFSGTIIKAKDELQKIGEKIIAIRDEARNAAQEEIKEAHATFDESARE LIRRFEEARASDAAQYREEFELEREKLAHAYQEKIRTELLRAQEVAEQRLQNELVEQAIE LNRKYLHEVKDLVEREREGRLSKLNELTTNVTELEKLTTDWKEVIDTNLKTQQLQVAVDA VRSVLERSTVPRPFVRELVAVKELAAEDPVVEAAIASINPTAYQRGIPSTAQIIERFRRV ADEVRKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESILIRTESLLEEGNIDAA AREMNTLKGWAKILSKDWLGDVRRVLEVKQALEVIETEARLQCLRVE
Uniprot No.

Target Background

Function

Recombinant Aspergillus clavatus Formation of crista junctions protein 1 (fcj1) is a component of the mitochondrial inner membrane MICOS complex. This large protein complex plays critical roles in maintaining crista junctions, inner membrane architecture, and forming contact sites with the outer membrane. fcj1 contributes to the connectivity of cristae membranes to the inner boundary membrane and facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its fundamental role in mitochondrial structure?

Fcj1 (Formation of crista junctions protein 1) is a mitochondrial protein specifically enriched at crista junctions (CJs), which are specialized structures connecting the inner boundary membrane to the cristae membranes in mitochondria. This protein plays a critical role in determining mitochondrial ultrastructure, particularly in the formation and maintenance of crista junctions. Studies have demonstrated that Fcj1 is also known as mic60, MICOS complex subunit mic60, or Mitofilin, based on its functional and structural characteristics .

The protein is essential for normal mitochondrial morphology, as evidenced by studies showing that cells lacking Fcj1 exhibit substantial alterations in mitochondrial ultrastructure. Specifically, deletion of Fcj1 results in the complete absence of crista junctions and leads to the formation of concentric stacks of inner membrane within the mitochondrial matrix . This fundamental structural role positions Fcj1 as a key determinant of mitochondrial inner membrane architecture.

What is the domain structure and characteristics of Fcj1 protein?

Recombinant Aspergillus clavatus Fcj1 protein has a well-defined domain structure with several functional regions:

  • N-terminal mitochondrial targeting sequence (MTS) for proper localization

  • Transmembrane segment anchoring the protein to the inner mitochondrial membrane

  • Coiled-coil domain involved in protein-protein interactions

  • Conserved C-terminal domain (CTD) that is shared across the mitofilin protein family

The full-length mature protein of A. clavatus Fcj1 spans amino acids 42-628, with a total of 587 amino acids in the mature form. The complete amino acid sequence includes regions rich in proline residues and charged amino acids that may contribute to its structural properties . Analysis of the protein reveals that it contains a predicted single transmembrane segment near the N-terminus, which anchors it to the inner mitochondrial membrane, while the majority of the protein projects into the intermembrane space .

Studies using biochemical methods have shown that Fcj1 is an integral membrane protein that cannot be extracted by high salt concentrations or sodium carbonate treatment, confirming its firm membrane integration .

How is Fcj1 localized within mitochondria and how can this be experimentally determined?

Fcj1 exhibits a highly specific localization pattern within mitochondria, with significant enrichment at crista junctions. This distinctive localization can be experimentally determined through quantitative immuno-electron microscopy (immuno-EM), which has proven to be an effective method for precise spatial mapping of mitochondrial proteins .

In the experimental approach, cryosections of chemically fixed cells are immunodecorated with antibodies against Fcj1 and visualized using immunogold labeling. The distribution of gold particles can then be mapped to various subdomains of the inner mitochondrial membrane, including the inner boundary membrane (IBM), cristae membrane (CM), and crista junctions (CJs) .

Quantitative analysis of immunogold particle distribution in wild-type cells has revealed that Fcj1 is most prominently clustered in close proximity to CJs, with lower abundance in the planar parts of the cristae. This enrichment pattern is unique to Fcj1 and has not been observed for other mitochondrial proteins analyzed using similar methods . Control experiments using Δfcj1 cells confirm the specificity of the antibody labeling, making this a reliable method for determining the precise localization of Fcj1 within the complex architecture of mitochondria .

What experimental systems are available for studying Fcj1 function?

Several experimental systems and approaches are available for investigating Fcj1 function:

  • Genetic manipulation in model organisms:

    • Knockout/deletion studies (Δfcj1) to assess loss-of-function effects

    • Overexpression systems to analyze gain-of-function phenotypes

    • Site-directed mutagenesis for structure-function analysis

  • Recombinant protein expression systems:

    • E. coli expression systems for producing His-tagged Fcj1 protein

    • Yeast expression systems for functional studies in a native-like environment

  • Imaging techniques:

    • Electron microscopy and tomography for ultrastructural analysis

    • Fluorescence microscopy using GFP-tagged variants for live-cell imaging

    • Immunogold labeling for precise localization studies

  • Biochemical approaches:

    • Affinity purification of tagged Fcj1 to identify interacting partners

    • Size exclusion chromatography to determine the native complex size (approximately 180 kD)

    • Co-immunoprecipitation experiments to study protein-protein interactions

These experimental systems allow researchers to investigate various aspects of Fcj1 function, from its role in maintaining mitochondrial ultrastructure to its interactions with other mitochondrial proteins such as components of the F1FO-ATP synthase complex .

What are the molecular mechanisms by which Fcj1 regulates crista junction formation?

Fcj1 regulates crista junction formation through an intricate mechanism involving the antagonistic modulation of F1FO-ATP synthase oligomerization. This mechanism involves several molecular interactions:

  • Antagonism with F1FO-ATP synthase subunits: Fcj1 acts in opposition to the subunits e and g (Su e/g) of F1FO-ATP synthase, which promote oligomerization of the complex. This antagonistic relationship locally modulates the oligomeric state of F1FO, thereby controlling membrane curvature of cristae to generate both crista junctions and cristae tips .

  • Direct role in determining CJ architecture: Overexpression studies have demonstrated that Fcj1 has a direct influence on both the number and architecture of CJs. When Fcj1 is overexpressed (5-10 fold above normal levels), the number of CJs per cell increases two- to three-fold compared to control cells .

  • Homotypic interactions: Biochemical studies using differently tagged variants of Fcj1 (His-tagged and TAP-tagged) have shown that Fcj1 can form homotypic interactions. Co-purification experiments demonstrated that Fcj1-His6 could be isolated together with Fcj1-TAP, indicating that Fcj1 proteins interact with each other to form oligomeric structures that may be important for their function at CJs .

  • Spatial organization: Quantitative immuno-EM analysis has revealed that Fcj1 is specifically enriched at CJs, while F1FO subunits e and g are more concentrated at cristae tips. This spatial segregation appears to be crucial for establishing the membrane curvature required for CJ formation .

The current working model suggests that Fcj1 locally prevents the formation of F1FO oligomers at sites where CJs form, whereas Su e/g promote F1FO oligomerization at cristae tips. This balanced antagonism helps establish the distinct membrane curvatures observed at different regions of the mitochondrial inner membrane .

What are the ultrastructural consequences of Fcj1 deletion or overexpression?

The manipulation of Fcj1 expression levels has profound effects on mitochondrial ultrastructure, providing valuable insights into its function:

Effects of Fcj1 deletion:

  • Complete absence of crista junctions in mitochondria

  • Formation of concentric stacks of inner membrane within the mitochondrial matrix

  • Increased levels of F1FO-ATP synthase supercomplexes

  • Organization of F1FO particles in a zipperlike arrangement with highly ordered, parallel lines in a square-like or hexagonal pattern

  • Consistent inter-particle distances of 14-16 nm in these ordered arrays

Effects of Fcj1 overexpression:

  • Increased number of crista junctions (2-3 fold more than in control cells)

  • Enhanced branching of cristae membranes

  • Enlargement of crista junction diameter

  • Reduced levels of F1FO supercomplexes

  • Disruption of the ordered arrangement of F1FO particles

These ultrastructural alterations demonstrate the crucial role of Fcj1 in determining mitochondrial inner membrane architecture. The observation that Fcj1 deletion leads to increased levels of F1FO supercomplexes, while overexpression reduces these levels, supports the model in which Fcj1 and the oligomeric state of F1FO have an antagonistic relationship in shaping cristae morphology .

How does Fcj1 interact with F1FO-ATP synthase and what is the functional significance?

Fcj1 interacts with F1FO-ATP synthase complexes in a manner that regulates their oligomerization state, which has significant functional implications for both mitochondrial ultrastructure and potentially bioenergetics:

  • Antagonistic regulation: Fcj1 appears to negatively regulate the formation of F1FO-ATP synthase oligomers, as evidenced by the increased levels of F1FO supercomplexes in Δfcj1 cells and reduced levels upon Fcj1 overexpression .

  • Spatial segregation: Immunogold labeling studies have revealed that Fcj1 is enriched at crista junctions, whereas F1FO subunits are more concentrated at cristae tips. This spatial separation suggests a model where local concentration gradients of these proteins help establish different membrane curvatures in distinct regions of the inner membrane .

  • Genetic interaction: Fcj1 shows genetic interaction with subunits e and g of F1FO-ATP synthase. While deletion of Fcj1 leads to ordered arrays of F1FO particles, additional deletion of subunit g (in Δfcj1/Δsu g mutants) disrupts this ordered arrangement, resulting in random distribution of F1FO particles with a broad range of inter-particle distances .

The functional significance of this interaction lies in its role in shaping the inner mitochondrial membrane. The antagonism between Fcj1 and F1FO subunits e and g allows for the formation of distinct membrane domains with different curvatures:

  • At crista junctions: High Fcj1 concentration inhibits F1FO oligomerization, promoting the negative membrane curvature required for CJ formation

  • At cristae tips: High concentration of F1FO oligomers (promoted by subunits e and g) generates the positive membrane curvature characteristic of these regions

This spatial regulation of membrane curvature is essential for establishing the complex architecture of the mitochondrial inner membrane, which in turn may affect mitochondrial function, including respiration and ATP production.

What are the optimal techniques for expressing and purifying functional recombinant Fcj1?

The expression and purification of functional recombinant Fcj1 requires specific techniques to maintain protein integrity and functionality:

Expression Systems:

  • E. coli expression system: Recombinant full-length Aspergillus clavatus Fcj1 protein (aa 42-628) can be efficiently expressed in E. coli when fused to an N-terminal His-tag . This system is advantageous for producing sufficient quantities of protein for biochemical and structural studies.

Purification Methods:

  • Affinity chromatography: His-tagged Fcj1 can be purified using nickel or cobalt affinity resins, allowing for selective isolation of the recombinant protein from bacterial lysates .

  • Size exclusion chromatography (SEC): SEC can be used as a second purification step to separate Fcj1 complexes based on their molecular size. Studies have shown that Fcj1-His12 complexes in Triton X-100-solubilized mitochondria have a size of approximately 180 kD .

Storage and Handling:

  • Lyophilization: Purified Fcj1 can be prepared as a lyophilized powder for long-term storage .

  • Buffer composition: For storage, Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been demonstrated to be effective .

  • Reconstitution protocol: The optimal reconstitution involves:

    • Brief centrifugation of the vial prior to opening

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol (final concentration 5-50%) for long-term storage

    • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage temperature: For extended preservation, storage at -20°C/-80°C is recommended, while working aliquots can be maintained at 4°C for up to one week .

The high purity of the recombinant protein (>90% as determined by SDS-PAGE) is crucial for functional studies and can be achieved through these optimized expression and purification protocols .

What approaches are most effective for studying Fcj1 protein-protein interactions?

Several complementary approaches have proven effective for investigating Fcj1 protein-protein interactions:

  • Co-expression and affinity purification: Co-expression of differently tagged variants of Fcj1 (e.g., His-tagged and TAP-tagged) followed by affinity purification has successfully demonstrated homotypic interactions between Fcj1 molecules. This approach allows for the identification of direct protein-protein interactions under near-native conditions .

  • Size exclusion chromatography (SEC): SEC analysis of detergent-solubilized mitochondrial extracts containing Fcj1-His12 has revealed that Fcj1 forms complexes of approximately 180 kD, providing insights into the oligomeric state of the protein in its native environment .

  • Genetic interaction studies: Analyzing the phenotypes of single and double deletion mutants (e.g., Δfcj1 vs. Δfcj1/Δsu g) has revealed functional interactions between Fcj1 and F1FO-ATP synthase subunits. This genetic approach complements biochemical methods and provides functional context for protein interactions .

  • Quantitative immuno-EM: This technique has been instrumental in determining the spatial relationship between Fcj1 and potential interacting partners within the mitochondrial ultrastructure. By mapping the distribution of different proteins relative to specific subdomains of the inner membrane, this approach can suggest functional relationships based on co-localization or spatial segregation .

  • Cryo-electron tomography: While not explicitly mentioned in the search results, this advanced imaging technique would be valuable for visualizing Fcj1-containing complexes in their native membrane environment at near-atomic resolution.

For detecting transient or weak interactions, approaches such as chemical cross-linking followed by mass spectrometry or proximity labeling methods (e.g., BioID, APEX) could provide additional insights into the Fcj1 interactome. These techniques would complement the established methods and potentially reveal novel interaction partners beyond those already identified.

What controls should be included when studying the effects of recombinant Fcj1 in experimental systems?

When designing experiments to study the effects of recombinant Fcj1, several critical controls should be included to ensure reliable and interpretable results:

  • Genetic controls:

    • Wild-type cells/organisms expressing endogenous Fcj1 at normal levels

    • Complete Fcj1 knockout (Δfcj1) to establish baseline phenotypes in the absence of the protein

    • Empty vector controls for overexpression studies to account for any effects of the expression system itself

  • Protein specificity controls:

    • Structurally similar but functionally unrelated proteins expressed using the same system and tags

    • Fcj1 mutants with alterations in key domains (transmembrane segment, coiled-coil domain, conserved C-terminal domain) to determine domain-specific functions

    • Tag-only controls to account for potential tag-related artifacts

  • Subcellular fractionation controls:

    • Marker proteins for different mitochondrial compartments (e.g., Tim44 for mitochondria)

    • Marker proteins for other cellular compartments (e.g., Erp1 for ER, Hxk1 for cytosol) to confirm the purity of mitochondrial preparations

  • Immunolocalization controls:

    • Secondary antibody-only controls to assess background labeling

    • Immunolabeling in Δfcj1 cells to confirm antibody specificity

    • Quantitative analysis of gold particle distribution across multiple cells and sections to ensure representative sampling

  • Biochemical interaction controls:

    • Non-interacting proteins subjected to the same co-purification procedures

    • Detergent and buffer condition variations to distinguish specific from non-specific interactions

    • Competition assays with unlabeled proteins to confirm binding specificity

Including these controls will help distinguish genuine Fcj1-specific effects from experimental artifacts and provide a solid foundation for interpreting the functional significance of observed phenotypes.

How can researchers optimize storage and reconstitution of recombinant Fcj1 for maximum stability and activity?

Optimizing storage and reconstitution of recombinant Fcj1 is critical for maintaining protein stability and functional activity over time. Based on the available information, the following protocols are recommended:

Storage Optimization:

  • Buffer composition:

    • Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides optimal stability for lyophilized Fcj1 protein

    • Alternative storage in Tris-based buffer with 50% glycerol has also been shown to be effective

  • Temperature conditions:

    • For long-term storage: -20°C to -80°C in aliquots to prevent repeated freeze-thaw cycles

    • For working solutions: 4°C for up to one week

  • Physical state:

    • Lyophilized powder form is recommended for extended storage periods

    • Protein solutions should be aliquoted to minimize freeze-thaw cycles

Reconstitution Protocol:

  • Initial preparation:

    • Briefly centrifuge the vial containing lyophilized protein before opening to bring contents to the bottom

    • This prevents loss of protein and ensures consistent reconstitution

  • Solubilization:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Gentle mixing rather than vigorous vortexing is recommended to prevent protein denaturation

  • Stabilization:

    • Add glycerol to a final concentration of 5-50% to enhance stability

    • The recommended default final concentration of glycerol is 50%

  • Quality control:

    • Verify protein integrity by SDS-PAGE after reconstitution

    • Assess functionality through appropriate activity assays depending on the experimental context

By following these optimized protocols for storage and reconstitution, researchers can maximize the stability and functional activity of recombinant Fcj1 protein, ensuring more reliable and reproducible experimental results.

How should researchers interpret ultrastructural changes in mitochondria after manipulation of Fcj1 levels?

Interpreting ultrastructural changes in mitochondria following Fcj1 manipulation requires a systematic approach that considers multiple parameters and controls:

  • Quantitative assessment of morphological features:

    • Count the number of crista junctions per mitochondrion in multiple cells and sections

    • Measure crista junction diameters using standardized methods

    • Quantify the degree of cristae branching and connectivity

    • Determine the spatial arrangement and distances between F1FO particles

  • Comparative analysis framework:

    • Compare observed changes to both wild-type controls and known phenotypes of related mutants (e.g., F1FO subunit deletions)

    • Consider dose-dependent effects by examining multiple expression levels (deletion, wild-type, moderate overexpression, high overexpression)

    • Analyze potential genetic interactions through double-mutant phenotypes

  • Structure-function correlation:

    • Correlate ultrastructural changes with biochemical measurements (e.g., levels of F1FO supercomplexes)

    • Consider the relationship between altered morphology and potential functional consequences

    • Interpret changes in the context of established models of mitochondrial membrane organization

  • Interpretation guidelines:

    • Increased numbers of CJs with Fcj1 overexpression supports its direct role in CJ formation

    • Concentric membrane stacks in Fcj1-deficient cells indicate a failure in normal cristae organization

    • Changes in the ordered arrangement of F1FO particles reflect alterations in membrane curvature regulation

    • Enlarged CJ diameter may indicate compromised control of membrane topology

  • Potential confounding factors:

    • Secondary effects due to altered respiratory function

    • Compensatory changes in other mitochondrial proteins

    • Sample preparation artifacts that might exaggerate or mask genuine ultrastructural changes

By systematically analyzing these parameters and considering both direct and indirect effects of Fcj1 manipulation, researchers can develop more robust interpretations of the observed ultrastructural changes and their significance for mitochondrial function.

What are the common pitfalls in analyzing protein-protein interactions involving Fcj1 and how can they be avoided?

Analyzing protein-protein interactions involving Fcj1 presents several challenges that researchers should be aware of to avoid misinterpretation of results:

  • Non-specific binding to affinity matrices:

    • Pitfall: His-tagged proteins can bind non-specifically to nickel or cobalt resins, leading to false positive interactions.

    • Solution: Include stringent washing steps, use appropriate controls (tag-only, unrelated His-tagged proteins), and validate interactions using multiple purification approaches .

  • Detergent-induced artifacts:

    • Pitfall: The choice of detergent for membrane protein solubilization can alter protein-protein interactions.

    • Solution: Compare results using different detergents (e.g., Triton X-100, digitonin, DDM) and validate key findings with complementary techniques like genetic interaction studies .

  • Overexpression artifacts:

    • Pitfall: Overexpressed proteins may form non-physiological interactions or aggregates.

    • Solution: Use expression systems that maintain near-native levels of proteins or validate interactions using endogenously tagged proteins .

  • Indirect interactions misinterpreted as direct:

    • Pitfall: Co-purification may reflect indirect associations within larger complexes rather than direct binding.

    • Solution: Use techniques that can distinguish direct interactions (e.g., crosslinking followed by mass spectrometry) or in vitro binding assays with purified components.

  • Overlooking transient or weak interactions:

    • Pitfall: Standard purification protocols may fail to capture important but transient interactions.

    • Solution: Employ chemical crosslinking prior to purification or use proximity labeling approaches to capture transient interactions.

  • Compartment-specific interactions:

    • Pitfall: Fcj1 is localized to specific subdomains of the inner mitochondrial membrane, and this spatial organization is critical for its function.

    • Solution: Use techniques like immuno-EM or super-resolution microscopy to correlate interaction data with spatial information about protein localization .

  • Failing to account for functional redundancy:

    • Pitfall: Some interactions may be masked by functionally redundant proteins.

    • Solution: Analyze interactions in genetic backgrounds where redundant factors are deleted or consider synthetic genetic interaction screens to identify functional relationships.

By recognizing these potential pitfalls and implementing appropriate experimental controls and validation strategies, researchers can increase the reliability of their protein-protein interaction data involving Fcj1 and develop more accurate models of its molecular function.

What are the promising research avenues for understanding the evolutionary conservation of Fcj1 function across fungal species?

The study of evolutionary conservation of Fcj1 function across fungal species represents a promising area for future research, with several specific directions worth pursuing:

  • Comparative genomic analysis:

    • Comprehensive sequence analysis of Fcj1 homologs across diverse fungal lineages to identify conserved domains and sequence motifs

    • Examination of co-evolution patterns between Fcj1 and its interaction partners, particularly components of the F1FO-ATP synthase complex

    • Analysis of gene synteny and regulatory elements to understand evolutionary constraints on Fcj1 expression

  • Structural biology approaches:

    • Determination of high-resolution structures of Fcj1 from multiple fungal species (including Aspergillus clavatus and Saccharomyces cerevisiae)

    • Comparative analysis of structural features to identify conserved functional elements

    • Investigation of species-specific structural adaptations that might reflect differences in mitochondrial architecture

  • Functional complementation studies:

    • Cross-species complementation experiments where Fcj1 from one fungal species (e.g., A. clavatus) is expressed in another species lacking its endogenous Fcj1 (e.g., S. cerevisiae Δfcj1)

    • Analysis of the degree of functional rescue to assess conservation of molecular mechanisms

    • Identification of species-specific functions through domain-swapping experiments

  • Comparative ultrastructural analysis:

    • Detailed characterization of mitochondrial cristae morphology across fungal species using electron tomography

    • Correlation of ultrastructural features with Fcj1 sequence and expression patterns

    • Investigation of environmental or metabolic factors that might influence Fcj1 function in different fungal species

  • Systems biology approaches:

    • Network analysis of Fcj1 interactions across multiple fungal species to identify core conserved functions versus species-specific adaptations

    • Integration of proteomic, transcriptomic, and metabolomic data to understand the broader functional context of Fcj1 in different fungi

    • Development of mathematical models to predict how variations in Fcj1 sequence and expression might affect mitochondrial architecture

These research directions would provide valuable insights into both the fundamental conserved functions of Fcj1 in mitochondrial architecture and species-specific adaptations that might reflect different metabolic or environmental requirements across the fungal kingdom.

How might advances in cryo-electron microscopy contribute to understanding Fcj1 structure and function?

Recent advances in cryo-electron microscopy (cryo-EM) offer transformative potential for understanding Fcj1 structure and function at unprecedented resolution:

  • High-resolution structural determination:

    • Single-particle cryo-EM could resolve the atomic or near-atomic structure of purified recombinant Fcj1, revealing critical details about domain organization and potential functional sites

    • The coiled-coil domains and conserved C-terminal region could be visualized to understand their structural basis for protein-protein interactions

    • Structure of Fcj1 in different conformational states might reveal mechanistic insights into its function

  • In situ structural analysis:

    • Cryo-electron tomography (cryo-ET) of intact mitochondria could visualize Fcj1 in its native membrane environment

    • Subtomogram averaging could resolve the structure of crista junctions and the organization of Fcj1 within these specialized membrane domains

    • Direct visualization of the spatial relationship between Fcj1 and F1FO-ATP synthase complexes in situ would provide critical insights into their functional antagonism

  • Visualizing dynamic processes:

    • Time-resolved cryo-EM approaches could capture different stages of crista junction formation or remodeling

    • Structural changes associated with Fcj1 overexpression or depletion could be directly visualized at molecular resolution

    • The effects of mutations in key domains could be correlated with structural alterations in the membrane architecture

  • Protein complex architecture:

    • Cryo-EM analysis of Fcj1-containing protein complexes could reveal the stoichiometry and arrangement of interaction partners

    • The molecular basis for homotypic Fcj1 interactions could be determined, including interfaces involved in oligomerization

    • Structures of Fcj1 in complex with components of the F1FO-ATP synthase could elucidate the mechanism of their antagonistic relationship

  • Technical innovations enabling new insights:

    • Cryo-focused ion beam (cryo-FIB) milling combined with cryo-ET would allow visualization of Fcj1 in thick cellular sections without artifacts associated with conventional sample preparation

    • Correlative light and electron microscopy (CLEM) could link dynamic behaviors observed by fluorescence microscopy with high-resolution structural information

    • In situ labeling approaches compatible with cryo-EM would enable precise localization of Fcj1 domains within the native context

These advanced cryo-EM approaches would bridge current knowledge gaps by connecting biochemical and genetic data with direct structural visualization of Fcj1 in action, potentially revolutionizing our understanding of how this protein shapes mitochondrial inner membrane architecture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.