Recombinant Aspergillus clavatus Golgi apparatus membrane protein tvp23 (tvp23)

What is TVP23 protein and what is known about its structure and localization?

TVP23 is a transmembrane protein localized to the Golgi apparatus, specifically found in the trans-Golgi network. In Aspergillus clavatus, TVP23 is a 191-amino acid protein with multiple transmembrane domains . The protein sequence (MDQPLQPQQGELNWRLSAHPITLLCFLGFRSSALLMYLFGVLFIKNFVLVFILTLLLLSADFYYLKNIAGRRLVGLRWWNEVNTSTGDSHWVFESSDPTTRTITATDKRFFWLGLYITPALWIGLAVLAIVTLSKIIWLSLVAIALILTITNTVAFSRCDRFGQASTFANRAFGGSIVSNNITGGLLGRLFK) reveals a highly hydrophobic protein consistent with its membrane localization . The UniProt ID for Aspergillus clavatus TVP23 is A1CIM7, and the gene is annotated as ACLA_052040 . The protein is evolutionarily conserved from fungi to mammals, suggesting fundamental importance in eukaryotic cellular function. TVP23 homologs have been identified in humans (TVP23A and TVP23B) and in other fungal species such as Aspergillus niger (UniProt ID: A2Q9P5) . This conservation across diverse species provides valuable opportunities for comparative and translational studies.

How should recombinant TVP23 proteins be stored and handled for optimal stability?

Proper storage and handling of recombinant TVP23 protein is critical for maintaining its structural integrity and functional properties. The protein is typically provided as a lyophilized powder that requires careful reconstitution and storage . According to multiple sources, the recommended storage conditions are:

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . When receiving lyophilized protein, it is advisable to briefly centrifuge the vial before opening to ensure all material is at the bottom . For reconstitution, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 50% and creating multiple small-volume aliquots can help prevent freeze-thaw damage and maintain protein stability during long-term storage .

What expression systems are used for producing recombinant Aspergillus clavatus TVP23?

Recombinant A. clavatus TVP23 protein is predominantly produced using prokaryotic expression systems, with E. coli being the most commonly utilized host organism . When expressed in E. coli, the full-length protein (amino acids 1-191) is typically fused to an N-terminal histidine tag to facilitate purification through affinity chromatography . The His-tag allows for single-step purification using metal affinity chromatography, resulting in protein preparations with greater than 90% purity as determined by SDS-PAGE .

While E. coli is the predominant expression system, alternative expression systems might offer advantages for specific research applications. Eukaryotic expression systems such as yeast, insect cells, or mammalian cells could potentially produce TVP23 with more native-like post-translational modifications, although the search results do not specifically mention these alternatives for A. clavatus TVP23 . The choice of expression system should be guided by the specific research questions being addressed and the required protein characteristics.

How does the amino acid sequence of TVP23 compare between different Aspergillus species?

Comparison of TVP23 sequences from different Aspergillus species reveals both conserved and variable regions, providing insights into functionally important domains. Below is a comparison between Aspergillus clavatus and Aspergillus niger TVP23 proteins:

What reconstitution protocols are recommended for lyophilized TVP23 recombinant proteins?

Proper reconstitution of lyophilized TVP23 protein is essential for experimental success. Based on the manufacturer's recommendations, the following protocol is advised:

• Centrifuge the vial briefly before opening to bring all material to the bottom .

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

• Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) for stability .

• Aliquot the reconstituted protein into small volumes to minimize freeze-thaw cycles .

• Store working aliquots at 4°C for up to one week .

• Store remaining aliquots at -20°C or -80°C for long-term preservation .

The reconstitution buffer composition can be critical depending on the downstream application. While water is recommended for initial reconstitution, specific buffer conditions might be necessary for certain experiments. For functional studies, researchers should consider using buffers that mimic physiological conditions (e.g., PBS-based buffers with appropriate pH and ionic strength). The addition of protease inhibitors may also be beneficial for preventing degradation during storage and experimentation.

What is the relationship between fungal TVP23 and mammalian homologs like TVP23B?

The evolutionary relationship between fungal TVP23 proteins and their mammalian homologs provides valuable insights into conserved cellular processes. TVP23 represents a family of transmembrane proteins that is remarkably conserved from yeast to humans, suggesting fundamental roles in eukaryotic cell biology . In mammals, two homologs exist: TVP23A and TVP23B, with TVP23B being better characterized functionally .

While the A. clavatus TVP23 functions primarily in the Golgi apparatus, recent research on the human homolog TVP23B has revealed its critical role in intestinal homeostasis . TVP23B has been shown to control the homeostasis of Paneth cells and function of goblet cells, leading to the production of antimicrobial peptides and maintenance of the mucus layer in the intestine . TVP23B deficiency in mammalian models resulted in a more penetrable mucus layer and disturbance in host-microbe balance .

How does TVP23 contribute to Golgi apparatus function and vesicular transport?

TVP23 plays a significant role in maintaining the structural and functional integrity of the Golgi apparatus. As a transmembrane protein localized to the trans-Golgi network, TVP23 is strategically positioned to participate in vesicular trafficking, protein sorting, and secretion . The protein's multiple transmembrane domains suggest it may function in membrane organization, vesicle formation, or cargo selection.

Research on mammalian TVP23B provides indirect evidence for the fungal protein's potential functions. TVP23B has been found to interact with another Golgi protein, YIPF6, which is critical for intestinal homeostasis . This interaction suggests TVP23 likely functions within a larger protein complex involved in vesicular transport. Furthermore, proteomic analysis of TVP23B-deficient cells revealed deficiencies in several critical glycosylation enzymes , suggesting TVP23 may play a role in maintaining the proper localization or function of these enzymes within the Golgi apparatus.

In fungal systems, TVP23 may be involved in similar processes, potentially regulating the trafficking of cell wall components, secreted enzymes, or other cargo essential for fungal growth and adaptation. The protein's high conservation across species suggests its fundamental importance in Golgi function. Experimental approaches such as co-immunoprecipitation, proximity labeling proteomics, or functional complementation studies could further elucidate TVP23's role in Golgi structure and function.

What experimental approaches are most effective for studying TVP23 protein interactions?

Given the membrane-embedded nature of TVP23, specialized experimental approaches are necessary to effectively study its protein-protein interactions and functional roles. Several methodologies are particularly suited for investigating TVP23:

• Proximity-based proteomics: Techniques such as BioID or APEX labeling, where TVP23 is fused to a biotin ligase or peroxidase, can identify proteins in close proximity to TVP23 within native cellular compartments.

• Split-reporter assays: Methods like bimolecular fluorescence complementation (BiFC) or split-luciferase assays can confirm direct interactions between TVP23 and candidate binding partners identified through other screening methods.

• Co-immunoprecipitation with membrane-specific modifications: Traditional co-IP protocols adapted for membrane proteins, using mild detergents that preserve membrane protein interactions, can identify stable binding partners.

• Yeast two-hybrid with membrane protein adaptations: Modified yeast two-hybrid systems designed specifically for membrane proteins (such as split-ubiquitin Y2H) can screen for interactors.

• Super-resolution microscopy: Techniques like STORM or PALM can visualize the spatial organization of TVP23 relative to other Golgi proteins with nanometer precision.

Research on mammalian TVP23B has successfully employed some of these approaches, revealing its interaction with YIPF6 . Similar strategies could be applied to fungal TVP23 to identify conserved and species-specific interaction partners. When designing such experiments, researchers should consider the hydrophobic nature of TVP23 and the potential for non-specific interactions with other membrane components.

What phenotypic effects have been observed in TVP23-deficient models?

While direct phenotypic studies of TVP23-deficient Aspergillus strains are not described in the provided search results, research on mammalian TVP23B homologs provides valuable insights into potential phenotypes. In mammalian models, mutation in TVP23B conferred susceptibility to chemically induced and infectious colitis . The absence of TVP23B disrupted the homeostasis of Paneth cells and impaired the function of goblet cells, leading to decreased production of antimicrobial peptides and a more penetrable intestinal mucus layer .

At the molecular level, TVP23B deficiency resulted in altered Golgi proteomes with notable deficiencies in several critical glycosylation enzymes . This finding suggests that TVP23 plays an important role in maintaining the proper localization or stability of these enzymes within the Golgi apparatus.

In fungal systems, TVP23 deficiency might similarly affect:

• Protein glycosylation and post-translational modifications

• Cell wall integrity and composition

• Secretion of extracellular enzymes

• Resistance to environmental stresses

• Morphology and growth characteristics

Creating TVP23 knockout or knockdown strains in Aspergillus species would allow for direct assessment of these potential phenotypes. Complementation studies using the recombinant protein could then confirm the specific roles of TVP23 in the observed phenotypes.

How can researchers effectively use TVP23 in studying Golgi apparatus dynamics and membrane organization?

Recombinant TVP23 protein represents a valuable tool for investigating Golgi apparatus dynamics and membrane organization. Several experimental strategies can leverage this resource:

• Reconstitution into artificial membrane systems: Purified TVP23 can be incorporated into liposomes or nanodiscs to study its effects on membrane curvature, fluidity, or domain formation in a controlled environment.

• In vitro vesicle formation assays: Recombinant TVP23 can be used in cell-free systems to assess its role in vesicle budding, fusion, or cargo selection.

• Structure determination: While challenging due to its membrane nature, structural studies of TVP23 (using techniques like cryo-EM or X-ray crystallography) could provide mechanistic insights into its function.

• Development of specific antibodies: Recombinant TVP23 can serve as an antigen for generating high-quality antibodies for immunolocalization, immunoprecipitation, or Western blotting.

• Protein-lipid interaction studies: Techniques like lipid overlay assays or liposome flotation assays using recombinant TVP23 can identify specific lipid interactions that might regulate its function.

When designing such experiments, researchers should consider the hydrophobic nature of TVP23 and the challenges associated with maintaining membrane protein stability and functionality in vitro. The use of appropriate detergents, lipid compositions, and buffer conditions is critical for success in these applications.

What quality control measures should be implemented when working with recombinant TVP23?

Ensuring the quality and functionality of recombinant TVP23 is essential for reliable experimental outcomes. Researchers should implement the following quality control measures:

How can TVP23 be used to study the role of the Golgi apparatus in fungal pathogenesis?

TVP23's conservation across pathogenic and non-pathogenic fungi makes it a valuable tool for studying the role of the Golgi apparatus in fungal pathogenesis. Several research approaches can leverage recombinant TVP23 for this purpose:

• Comparative studies: Analyzing TVP23 sequence, expression, and function across pathogenic and non-pathogenic Aspergillus species can identify pathogenesis-associated adaptations.

• Immune recognition studies: Investigating whether fungal TVP23 is recognized by host immune systems during infection can determine its potential as an immunogenic antigen.

• Inhibitor development: Using recombinant TVP23 in high-throughput screening assays to identify compounds that specifically disrupt its function could lead to novel antifungal strategies.

• Host-pathogen interaction models: Studying how TVP23 dysfunction affects the secretion of virulence factors, host cell adhesion, or immune evasion can elucidate its role in pathogenesis.

• Biomarker development: Exploring whether TVP23 or its associated vesicles are released during infection could lead to new diagnostic approaches.

While not specifically focused on pathogenesis, studies on mammalian TVP23B have demonstrated its importance in maintaining the intestinal barrier against microbial invasion . This finding suggests that fungal TVP23 might similarly be involved in cell surface integrity and interaction with host environments. Targeted genetic modification of TVP23 in pathogenic Aspergillus strains, combined with infection models, could directly test its contribution to virulence.

What are the challenges and considerations in designing experiments with TVP23 recombinant proteins?

Working with recombinant TVP23 presents several unique challenges due to its nature as a multi-pass transmembrane protein. Researchers should consider the following issues when designing experiments:

• Protein solubility: As a membrane protein, TVP23 has hydrophobic domains that can cause aggregation in aqueous solutions. Selection of appropriate detergents or lipid environments is crucial for maintaining solubility without disrupting native structure .

• Maintaining native conformation: The functional conformation of TVP23 depends on proper membrane integration. In vitro studies may require reconstitution into membrane mimetics (liposomes, nanodiscs, or detergent micelles) to preserve native structure.

• Tag interference: While His-tags facilitate purification, they may interfere with function or localization. Control experiments with untagged versions or alternative tag positions should be considered .

• Species-specific interactions: When using A. clavatus TVP23 to study interactions in other systems, researchers should be aware of potential species-specific differences. Sequence comparison between homologs can help identify conserved interaction domains .

• Post-translational modifications: TVP23 expressed in E. coli will lack eukaryotic post-translational modifications that may be present in the native protein. For studies where these modifications are important, eukaryotic expression systems might be preferable.

What analytical techniques are most appropriate for characterizing TVP23 structure-function relationships?

Understanding the structure-function relationships of TVP23 requires specialized analytical techniques suitable for membrane proteins. The following methods are particularly valuable:

These techniques should be applied in a complementary manner, as each provides different types of structural information. The amino acid sequence of TVP23 (191 residues in A. clavatus) suggests a relatively small protein with multiple transmembrane domains , which presents both challenges and opportunities for structural analysis. The high degree of sequence conservation between different species can also guide the identification of functionally important regions.

How can cross-species comparison of TVP23 proteins inform functional studies?

Cross-species comparison of TVP23 proteins provides a powerful approach for identifying conserved functional domains and species-specific adaptations. This comparative approach can guide experimental design in several ways:

• Identification of conserved motifs: Sequence alignment of TVP23 from Aspergillus clavatus, Aspergillus niger, and other species can highlight highly conserved regions likely to be functionally important . These regions should be prioritized in mutagenesis studies.

• Recognition of species-specific variations: Differences in sequence between homologs may indicate adaptations to specific ecological niches or functional specializations. For example, comparing the sequences of A. clavatus (MDQPLQPQQGELNWRLSAHPITLLCFLGFRSSALLMYLFGVLFIKNFVLVFILTLLLLSADFYYLKNIAGRRLVGLRWWNEVNTSTGDSHWVFESSDPTTRTITATDKRFFWLGLYITPALWIGLAVLAIVTLSKIIWLSLVAIALILTITNTVAFSRCDRFGQASTFANRAFGGSIVSNNITGGLLGRLFK) and A. niger TVP23 reveals subtle differences that might reflect species-specific functions .

• Functional complementation experiments: Determining whether TVP23 from one species can rescue phenotypes in another species lacking its native TVP23 can provide insights into functional conservation.

• Evolutionary rate analysis: Examining the evolutionary rate of different regions of TVP23 can identify segments under purifying selection (highly conserved) versus those under diversifying selection (rapidly evolving).

• Domain swapping experiments: Creating chimeric proteins with domains from different species' TVP23 homologs can help map the regions responsible for species-specific functions.

The evolutionary relationship between fungal TVP23 and mammalian homologs like TVP23B is particularly interesting, as it suggests ancient conserved functions in the Golgi apparatus. Human TVP23B's role in intestinal homeostasis might provide clues about fundamental cellular processes regulated by this protein family across all eukaryotes.